USP8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• USP8 Polyclonal antibody (27791-1-AP)

• Featured Product
• KD/KO Validated

USP8 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27791-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:3.4.19.12, hUBPy, HumORF8, KIAA0055, Ubiquitin carboxyl-terminal hydrolase 8

• 

  WB analysis using 27791-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 27791-1-AP (USP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 27791-1-AP

  WB result of USP8 antibody (27791-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-USP8 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 27791-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27791-1-AP (USP8 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 27791-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27791-1-AP (USP8 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 27791-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27791-1-AP (USP8 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 27791-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using USP8 antibody (27791-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for USP8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27791-1-AP targets USP8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27143

  Product name: Recombinant human USP8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-253 aa of BC110590

  Sequence: SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV

• Full Name: ubiquitin specific peptidase 8
• Calculated Molecular Weight: 1118 aa, 128 kDa
• Observed Molecular Weight: 128 kDa
• GenBank Accession Number: BC110590
• Gene Symbol: USP8
• Gene ID (NCBI): 9101
• RRID: AB_2880973
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40818
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP8 is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo sorting and membrane trafficking at the early endosome stage.

Publications

What published studies show

The USP8 Polyclonal antibody (Cat# 27791-1-AP) has 18 citations. These appear in journals including Journal of Experimental & Clinical Cancer Research, Advanced Science, Cell Death & Differentiation, Cell & Molecular Biology Letters, Acta Pharmacologica Sinica, Aging Disease, EMBO Molecular Medicine, Science of the Total Environment, International Immunopharmacology, Cancers, Archives of Biochemistry & Biophysics, Frontiers in Oncology, Veterinary Microbiology, Cancer Management & Research, eLife, and International Immunopharmacology. Research fields span oncology (lung, bladder, pancreatic, prostate, colorectal, cholangiocarcinoma, pituitary tumors), immunology, neuroinflammation, stroke, metabolism, and virology.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Exp Clin Cancer Res; Glucocorticoid modulatory element-binding protein 1 (GMEB1) interacts with the de-ubiquitinase USP40 to stabilize CFLARL and inhibit apoptosis in human non-small cell lung cancer cells.; Authors - Wentao An
mouse,human	WB,IHC	J Exp Clin Cancer Res; Tumorigenesis of basal muscle invasive bladder cancer was mediated by PTEN protein degradation resulting from SNHG1 upregulation; Authors - Tengda Li ; KD Validated
		Adv Sci (Weinh); PFKFB4 Deubiquitination by USP10 Enhances Fumarate Metabolism to Orchestrate the KDM1A/Rad51 Axis and Confer Radioresistance in Lung Cancer.; Authors - Yunshang Chen
human,mouse	WB	Adv Sci (Weinh); USP8-Governed MDA5 Homeostasis Promotes Innate Immunity and Autoimmunity; Authors - Qimin Zhang ; KD Validated
mouse,human	WB,IHC,IF	Cell Death Differ; Targeting ubiquitin-specific protease 8 sensitizes anti-programmed death-ligand 1 immunotherapy of pancreatic cancer; Authors - Hanshen Yang
		Cell Mol Biol Lett; Targeting SLK protects against cerebral ischemia-reperfusion injury by regulating USP8-mediated HIF-1α stabilization and RhoA/ROCK activation.; Authors - Yuetao Wen