USP8 Monoclonal antibody, PBS Only

• 

  WB analysis using 67321-1-Ig (same clone as 67321-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67321-1-Ig (USP8 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67321-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67321-1-Ig (same clone as 67321-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67321-1-Ig (USP8 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67321-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67321-1-Ig (same clone as 67321-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67321-1-Ig (USP8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67321-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67321-1-Ig (same clone as 67321-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67321-1-Ig (USP8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67321-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67321-1-Ig (same clone as 67321-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67321-1-Ig (USP8 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67321-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67321-1-Ig (same clone as 67321-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67321-1-Ig (USP8 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67321-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67321-1-Ig (same clone as 67321-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67321-1-Ig (USP8 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67321-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67321-1-Ig (same clone as 67321-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using USP8 antibody (67321-1-Ig, Clone: 1E12E3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67321-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Hela using 67321-1-Ig (same clone as 67321-1-PBS)

  1X10^6 Hela cells were intracellularly stained with 0.4 ug Anti-Human USP8 (67321-1-Ig, Clone:1E12E3) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67321-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67321-1-Ig (same clone as 67321-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human USP8 (67321-1-Ig, Clone:1E12E3) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67321-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

USP8 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 67321-1-PBS

Clone No.1E12E3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

1E12E3, EC:3.4.19.12, hUBPy, HumORF8, KIAA0055

---

Product Information

67321-1-PBS targets USP8 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27104

  Product name: Recombinant human USP8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 15-253 aa of BC110590

  Sequence: SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV

• Full Name: ubiquitin specific peptidase 8
• Calculated Molecular Weight: 1118 aa, 128 kDa
• Observed Molecular Weight: 128 kDa
• GenBank Accession Number: BC110590
• Gene Symbol: USP8
• Gene ID (NCBI): 9101
• RRID: AB_2882581
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40818
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.