USP8 Recombinant monoclonal antibody, PBS Only (Capture)

USP8 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83172-2-PBS
Clone No.240016D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

240016D3, EC:3.4.19.12, hUBPy, HumORF8, KIAA0055

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83172-2-PBS targets USP8 as part of a matched antibody pair:

MP00188-1: 83172-2-PBS capture and 83172-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27143

Product name: Recombinant human USP8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 15-253 aa of BC110590

Sequence: SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV

Predict reactive species
Full Name ubiquitin specific peptidase 8
Calculated Molecular Weight 1118 aa, 128 kDa
Observed Molecular Weight128 kDa
GenBank Accession NumberBC110590
Gene Symbol USP8
Gene ID (NCBI) 9101
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP40818
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

USP8 is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo sorting and membrane trafficking at the early endosome stage.

Loading...
||
New chat Able
正在加载,请稍候...