USP9Y Polyclonal antibody

• 

  WB analysis using 32373-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32373-1-AP (USP9Y antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

USP9Y Polyclonal Antibody for WB, ELISA

Cat No. 32373-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Deubiquitinating enzyme FAF-Y, DFFRY, EC:3.4.19.12, Fat facets protein-related, Y-linked, Ubiquitin carboxyl-terminal hydrolase 9Y

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32373-1-AP targets USP9Y in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35809

  Product name: Recombinant human USP9Y protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2361-2555 aa of NM_004654

  Sequence: KGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCPVAYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYSYNNWSPPVQSNETANGYFLERSHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ

• Full Name: ubiquitin specific peptidase 9, Y-linked
• Calculated Molecular Weight: 291kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: NM_004654
• Gene Symbol: USP9Y
• Gene ID (NCBI): 8287
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O00507
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP9Y (Ubiquitin-Specific Peptidase 9 on the Y chromosome) is a gene located in the male-specific region of the Y chromosome and is broadly expressed in male adult tissues. It encodes a functional deubiquitinating enzyme that plays a role in protein turnover (PMID: 39742627).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Karthik (Verified Customer) (04-22-2026)

We are going to measure the USP9Y protein expression with human cancer lines.

• Applications: Western Blot, Cell culture
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Eukaryotic