UST Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UST Polyclonal antibody, PBS Only (27578-1-PBS)

• 

  WB analysis using 27578-1-AP (same clone as 27578-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27578-1-AP (UST antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27578-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 27578-1-AP (same clone as 27578-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27578-1-AP (UST antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27578-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 27578-1-AP (same clone as 27578-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using UST antibody (27578-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 27578-1-PBS in a different storage buffer formulation.

UST Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 27578-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

2OST, uronyl 2 sulfotransferase

---

Product Information

27578-1-PBS targets UST in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25483

  Product name: Recombinant human UST protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-406 aa of BC093668

  Sequence: PRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGDQPVYINIIRDPVNRFLSNYFFRRFGDWRGEQNHMIRTPSMRQEERYLDINECILENYPECSNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLLVGILEELEDVLLLLERFLPHYFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHYVKEQFHLLKRKFGLKSHVSKPPLRPHFFIPTPLETEEPIDDEEQDDEKWLEDIYKR

• Full Name: uronyl-2-sulfotransferase
• Calculated Molecular Weight: 406 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC093668
• Gene Symbol: UST
• Gene ID (NCBI): 10090
• RRID: AB_3669611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2C2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UST (Uronyl 2-sulfotransferase) is an enzyme that catalyzes the transfer of sulfate groups to the 2-position of uronyl residues, such as iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate (PMID: 10187838). UST is a critical regulator of melanoma cell adhesion and motility in vitro and in vivo. Abnormal expression or activity of UST has also been associated with certain diseases, such as breast pericanalicular fibroadenoma and acute retinal necrosis (PMID: 25480151).