UT-B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UT-B Polyclonal antibody (25962-1-AP)

UT-B Polyclonal Antibody for WB, ELISA

Cat No. 25962-1-AP Copied!

Publications (3)

Reviews (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF, ELISA

Synonyms

HUT11, JK, RACH1, SLC14A1, Urea transporter 1, Urea transporter, erythrocyte, UT B1, UT1, UT-B

• 

  WB analysis of mouse kidney using 25962-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 25962-1-AP (UT-B antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 25962-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 25962-1-AP (UT-B antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UT-B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25962-1-AP targets UT-B in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6769

  Product name: Recombinant human SLC14A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 188-389 aa of BC050539

  Sequence: LSATGHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFLIMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPL

• Full Name: solute carrier family 14 (urea transporter), member 1 (Kidd blood group)
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 48-55 kDa
• GenBank Accession Number: BC050539
• Gene Symbol: UT-B
• Gene ID (NCBI): 6563
• RRID: AB_2880311
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13336
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The UT-B Polyclonal antibody (Cat# 25962-1-AP) has 3 total citations. These appear in Frontiers in Oncology, Animals (Basel), and Biomedical Research International. The associated research fields include prostate cancer immune-related gene analysis (WB, human), rumen fermentation and sheep nutrition (IF, sheep), and uremic sweat gland expression of AQP5 and urea transporters (WB, human). Applications span Western blot and immunofluorescence across human and sheep species.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; WGCNA-ML-MR integration: uncovering immune-related genes in prostate cancer; Authors - Jing Lv
sheep	IF	Animals (Basel); Rumen-Degradable Starch Improves Rumen Fermentation, Function, and Growth Performance by Altering Bacteria and Its Metabolome in Sheep Fed Alfalfa Hay or Silage; Authors - Wenliang Guo
human	WB	Biomed Res Int; The Expression of AQP5 and UTs in the Sweat Glands of Uremic Patients.; Authors - Liyi Xie

Reviews

4.0 out of 5

2 verified customer reviews

What customers say

Both reviewers rated the antibody 4 out of 5 stars. Users reported consistent performance in Western Blot at a 1:1000 dilution, with one also confirming reliable results in Flow Cytometry on bladder cancer cell lines. Overall, customers found the antibody to be working well for its intended applications.

Automatically generated from the 2 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Prakash (Verified Customer) (11-07-2025)

working good in western and FACS

• Applications: Western Blot, Flow Cytometry
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: bladder cancer cell lines

Prakash (Verified Customer) (10-17-2025)

antibody working well in western blot

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000