UTRN Polyclonal antibody

• 

  WB analysis using 27948-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27948-1-AP (UTRN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 27948-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27948-1-AP (UTRN antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 27948-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27948-1-AP (UTRN antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

UTRN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27948-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IHC, ELISA

Synonyms

DMDL, DRP, DRP 1, DRP1, Dystrophin related protein 1, UTRN, utrophin

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27948-1-AP targets UTRN in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27497

  Product name: Recombinant human UTRN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 711-932 aa of NM_007124

  Sequence: MQTTEIKEYMKMQDTSEMKKKLKALEKEQRERIPRADELNQTGQILVEQMGKEGLPTEEIKNVLEKVSSEWKNVSQHLEDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSISESSRQSLPSLKDSCQRELTNLLGLHPKIEMARASCSALMSQPSAPDFVQRGFDSFLGRYQAVQEAVEDRQQHLENELKGQPGHAYLETLKTLKDVLNDSENKAQV

• Full Name: utrophin
• Calculated Molecular Weight: 395 kDa
• Observed Molecular Weight: 394 kDa, 70 kDa
• GenBank Accession Number: NM_007124
• Gene Symbol: UTRN
• Gene ID (NCBI): 7402
• RRID: AB_2881018
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46939
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Utrophin is a large protein (395 kDa) which is widely expressed and most abundant in several non-skeletal muscle tissues, for example lung, intestine, embryonic neural tube, sensory ganglia, tendons and ossifying cartilages. Two alternate intronic transcripts of utrophin have been described: Up71 and Up140.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Transcriptional adaptation upregulates utrophin in Duchenne muscular dystrophy; Authors - Lara Falcucci