Tested Applications
| Positive WB detected in | T-47D cells, Transfected HEK-293 cells, mouse brain tissue, rat brain tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22126-1-AP targets Ubiquilin 1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17530 Product name: Recombinant human Ubiquilin 1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 324-376 aa of BC010066 Sequence: WAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPG Predict reactive species |
| Full Name | ubiquilin 1 |
| Calculated Molecular Weight | 589 aa, 63 kDa |
| Observed Molecular Weight | 63-71 kDa |
| GenBank Accession Number | BC010066 |
| Gene Symbol | Ubiquilin 1 |
| Gene ID (NCBI) | 29979 |
| RRID | AB_2879000 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UMX0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UBQLN1, also known as DSK2 or Ubiquilin 1, is an ubiquitin-like proteinis contains a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.Ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene. Higher levels of ubiquilin-1 in the brain decreased malformation of the APP molecule which plays a key role in triggering Alzheimers disease.Conversely, lower levels of ubiquilin-1 in the brain were associated with increased malformation of APP (PMID: 21852239). This antibody detects 70kD band of UBQLN1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Ubiquilin 1 antibody 22126-1-AP | Download protocol |
| WB protocol for Ubiquilin 1 antibody 22126-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Phytomedicine Kaempferol functionally reprograms CD47 signaling to promote cytoprotection and attenuate oxeiptosis in severe acute pancreatitis. | ||
iScience Ubiquitination and degradation of CD47 enhances macrophage phagocytosis of hemolytic erythrocytes. | ||
Cell Rep Ubiquilin1 restricts influenza viral replication through trapping vRNP in the late endosomes.
| ||
Biomaterials Harnessing the HMnO(2) nanoparticles as the DNA injury amplifier to improve the OXA-based trans-artery infusion chemotherapy. |





