Unc119b Polyclonal antibody

• 

  WB analysis using 26201-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26201-1-AP (Unc119b antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MDCK using 26201-1-AP

  MDCK cells were subjected to SDS PAGE followed by western blot with 26201-1-AP (Unc119b Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 26201-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 26201-1-AP (Unc119b Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MDCK using 26201-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MDCK cells using 26201-1-AP (Unc119b antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

Unc119b Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26201-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, Canine

Applications

WB, IF/ICC, ELISA

Synonyms

AA407659, AI414892, unc 119 homolog B (C. elegans), Unc119b

---

Tested Applications

• Positive WB detected in: A549 cells, MDCK cells, mouse kidney tissue, HEK-293 cells, HeLa cells
• Positive IF/ICC detected in: MDCK cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26201-1-AP targets Unc119b in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, Canine samples.

• Tested Reactivity: human, mouse, Canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24599

  Product name: Recombinant mouse Unc119b protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-251 aa of BC008617

  Sequence: MSGSNPKAATAGSQAGPGGLVAGKEEKKKAGGGVLNRLKARRQGPPHTPDDGSGAAVTEQELLALDTIRPEHVLRLNRVTENYLCKPEDNVYSIDFTRFKIRDLETGTVLFEIAKPCISDQDQDAEEESVDVDISVGRFVRYQFTPAFLRLRTVGATVEFTVGDRPVTGFRMIERHYFRERLLKTFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLVMHNKADYAYNGGQ

• Full Name: unc-119 homolog B (C. elegans)
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-31 kDa
• GenBank Accession Number: BC008617
• Gene Symbol: Unc119b
• Gene ID (NCBI): 106840
• RRID: AB_2880422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8C4B4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mouse Unc119b is related closely to Unc119, a homolog of C. elegans unc119 protein which was first discovered in C. elegans on the basis of a spontaneous mutation affecting locomotion, feeding behavior and chemosensation. Mouse Unc119b shares 90% sequence identity with human UNC119b protein. UNC119b is a myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Myristoyl-binding activity of UNC119b is required to localize NPHP3 to the primary cilium (PMID: 22085962).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Francesc R (Verified Customer) (06-14-2022)

Great results by Western blot, with band of right size that disappears in CRISPR KO clones. In attached image, lanes 1-5 are HEK293T clones (three of them UNC119B-KO) and lanes 6-11 are hTERT-RPE1 clones (all containing the protein).

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK293T and hTERT-RPE1

Unc119b Antibody Western Blot validation (1:1000 dilution) in HEK293T and hTERT-RPE1 (Cat no:26201-1-AP)