Unc119b Polyclonal antibody

Unc119b Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 26201-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, Canine

Applications

WB, IF/ICC, ELISA

AA407659, AI414892, unc 119 homolog B (C. elegans), Unc119b

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, MDCK cells, mouse kidney tissue, HEK-293 cells, HeLa cells
Positive IF/ICC detected inMDCK cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26201-1-AP targets Unc119b in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, Canine samples.

Tested Reactivity human, mouse, Canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24599

Product name: Recombinant mouse Unc119b protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-251 aa of BC008617

Sequence: MSGSNPKAATAGSQAGPGGLVAGKEEKKKAGGGVLNRLKARRQGPPHTPDDGSGAAVTEQELLALDTIRPEHVLRLNRVTENYLCKPEDNVYSIDFTRFKIRDLETGTVLFEIAKPCISDQDQDAEEESVDVDISVGRFVRYQFTPAFLRLRTVGATVEFTVGDRPVTGFRMIERHYFRERLLKTFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLVMHNKADYAYNGGQ

Predict reactive species
Full Name unc-119 homolog B (C. elegans)
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28-31 kDa
GenBank Accession NumberBC008617
Gene Symbol Unc119b
Gene ID (NCBI) 106840
RRIDAB_2880422
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8C4B4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mouse Unc119b is related closely to Unc119, a homolog of C. elegans unc119 protein which was first discovered in C. elegans on the basis of a spontaneous mutation affecting locomotion, feeding behavior and chemosensation. Mouse Unc119b shares 90% sequence identity with human UNC119b protein. UNC119b is a myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Myristoyl-binding activity of UNC119b is required to localize NPHP3 to the primary cilium (PMID: 22085962).

Protocols

Product Specific Protocols
WB protocol for Unc119b antibody 26201-1-APDownload protocol
IF protocol for Unc119b antibody 26201-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Francesc R (Verified Customer) (06-14-2022)

Great results by Western blot, with band of right size that disappears in CRISPR KO clones. In attached image, lanes 1-5 are HEK293T clones (three of them UNC119B-KO) and lanes 6-11 are hTERT-RPE1 clones (all containing the protein).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T and hTERT-RPE1
Unc119b Antibody Western Blot validation (1:1000 dilution) in HEK293T and hTERT-RPE1 (Cat no:26201-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...