VAChT Polyclonal antibody

• 

  WB analysis using 27303-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27303-1-AP (VAChT antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

VAChT Polyclonal Antibody for WB, ELISA

Cat No. 27303-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

SLC18A3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27303-1-AP targets VAChT in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25153

  Product name: Recombinant human SLC18A3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 410-501 aa of BC007765

  Sequence: DVRHVSVYGSVYAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPPQGLYDAVRLRE

• Full Name: solute carrier family 18 (vesicular acetylcholine), member 3
• Calculated Molecular Weight: 532 aa, 57 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC007765
• Gene Symbol: VAChT
• Gene ID (NCBI): 6572
• RRID: AB_3669592
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16572
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC18A3 also known as VAChT, is the vesicular amine transporter family member. The SLC18A3 gene encodes a transmembrane protein that transports acetylcholine (ACh) into presynaptic secretory vesicles for release at cholinergic nerve endings in the central and peripheral nervous systems. Mutations in SLC18A3 are associated with congenital myasthenic syndrome(PMID: 27590285). The 68-70 kDa mature glycosylated form of VAChT can be detected (PMID: 14705140).