Tested Applications
| Positive WB detected in | human brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13115-1-AP targets VAMP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3787 Product name: Recombinant human VAMP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC023286 Sequence: MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIM Predict reactive species |
| Full Name | vesicle-associated membrane protein 1 (synaptobrevin 1) |
| Calculated Molecular Weight | 117 aa, 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC023286 |
| Gene Symbol | VAMP1 |
| Gene ID (NCBI) | 6843 |
| RRID | AB_2214772 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23763 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP1, also named as synaptobrevin 1, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP1 is a part of the SNARE (soluble NSF-attachment protein receptor) complex. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP1 is involved in synaptic vesicle exocytosis, a fundamental step in neurotransmitter release.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VAMP1 antibody 13115-1-AP | Download protocol |
| IHC protocol for VAMP1 antibody 13115-1-AP | Download protocol |
| WB protocol for VAMP1 antibody 13115-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VAMP1 Polyclonal antibody (Cat# 13115-1-AP) has 6 citations published in Pharmacological Research, EMBO Journal, BMC Cancer, European Journal of Immunology, Neurotoxicology, and Neuroscience. Research fields span addiction (morphine craving), epidermal biology, renal cell carcinoma biomarkers, neuroinflammation and blood-brain barrier immunology, arsenite-induced neurotoxicity, and inflammatory pain signaling. Applications include Western blot and immunofluorescence in mouse, rat, and human samples.
| Species | Application | Title |
|---|---|---|
EMBO J Binary organization of epidermal basal domains highlights robustness to environmental exposure | ||
BMC Cancer Identification and validation of prognostic biomarkers in ccRCC: immune-stromal score and survival prediction | ||
Eur J Immunol ACKR1 favors transcellular over paracellular T-cell diapedesis across the blood-brain barrier in neuroinflammation in vitro. | ||
Neurotoxicology Heterozygous disruption of beclin 1 alleviates neurotoxicity induced by sub-chronic exposure of arsenite in mice | ||
Neuroscience SNAP25/syntaxin4/VAMP2/Munc18-1 Complexes in Spinal Dorsal Horn Contributed to Inflammatory Pain. |
