Tested Applications
| Positive WB detected in | mouse testis tissue, HEK-293 cells, mouse brain tissue, SH-SY5Y cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10738-1-AP targets VAMP4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1090 Product name: Recombinant human VAMP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC007019 Sequence: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT Predict reactive species |
| Full Name | vesicle-associated membrane protein 4 |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC007019 |
| Gene Symbol | VAMP4 |
| Gene ID (NCBI) | 8674 |
| RRID | AB_2212788 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75379 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP4 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP4 may play a role in trans-Golgi network to endosome transport.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VAMP4 antibody 10738-1-AP | Download protocol |
| IHC protocol for VAMP4 antibody 10738-1-AP | Download protocol |
| IP protocol for VAMP4 antibody 10738-1-AP | Download protocol |
| WB protocol for VAMP4 antibody 10738-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VAMP4 Polyclonal antibody (Cat# 10738-1-AP) has 10 citations published in journals including Nature Communications, Cell Molecular Life Sciences, Journal of Cell Biology, Structure, Journal of Biological Chemistry, Biochemical Journal, Cancer Genomics Proteomics, and Biophysical Reports. Research fields span vesicular trafficking and male fertility, exosome-mediated ischemia-reperfusion injury, insulin secretion and secretory granule proteomics, retrograde membrane trafficking, lipid acylation, monocyte migration, neurite outgrowth, phosphoproteomics of endosomal proteins, and hepatocellular carcinoma oncology.
| Species | Application | Title |
|---|---|---|
Nat Commun SYPL1 defines a vesicular pathway essential for sperm cytoplasmic droplet formation and male fertility | ||
Cell Mol Life Sci VAMP4 in hypoxic adipose stem cell exosomes alleviates ischemia-reperfusion injury. | ||
J Cell Biol VAMP4 regulates insulin levels by targeting secretory granules to lysosomes
| ||
Structure Cryo-EM structure of the WDR11-FAM91A1-C17orf75 complex involved in retrograde trafficking. | ||
J Biol Chem Glia Maturation Factor-γ Regulates Monocyte Migration through Modulation of β1-Integrin. | ||
J Biol Chem Competition for cysteine acylation by C16:0 and C18:0 derived lipids is a global phenomenon in the proteome |
Reviews
What customers say
The single review for 10738-1-AP is from a researcher who used it for immunofluorescence on primary hippocampal neurons (Rat E17) at a 1:75 dilution. They rated it 4 out of 5 and reported that the antibody works reliably for immuno-fluorescent staining of primary neuron cultures from rat embryos. Overall, the feedback is positive, confirming consistent performance in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Priyadarshini (Verified Customer) (04-30-2020) | The antibody works reliably for immuno-fluorescent staining of primary neuron cultures from rat embryos.
 |
