VAMP5 Polyclonal antibody

• 

  WB analysis of human lung using 11822-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11822-1-AP (VAMP5 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human peripheral blood leukocyte using 11822-1-AP

  Human peripheral blood leukocyte cells were subjected to SDS PAGE followed by western blot with 11822-1-AP (VAMP5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 11822-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 11822-1-AP (VAMP5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 11822-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11822-1-AP (VAMP5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 11822-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11822-1-AP (VAMP5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

VAMP5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11822-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Myobrevin, VAMP 5, VAMP5

---

Tested Applications

• Positive WB detected in: human lung tissue, mouse kidney tissue, Human peripheral blood leukocyte cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

11822-1-AP targets VAMP5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2390

  Product name: Recombinant human VAMP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-116 aa of BC017891

  Sequence: MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

• Full Name: vesicle-associated membrane protein 5 (myobrevin)
• Calculated Molecular Weight: 12.8 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC017891
• Gene Symbol: VAMP5
• Gene ID (NCBI): 10791
• RRID: AB_2212965
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95183
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAMP5, also known as myobrevin, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP5 may participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Front Immunol; Immune Gene Signatures and Immunotypes in Immune Microenvironment Are Associated With Glioma Prognose.; Authors - Xiang-Xu Wang
human	WB	Front Mol Neurosci; Construction and validation of a risk model based on the key SNARE proteins to predict the prognosis and immune microenvironment of gliomas; Authors - Luxin Yin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Boyan (Verified Customer) (06-19-2020)

This antibody labels a ~ 25 kD band, but not a 15 kD band, in 293T cell lysate - not sure is this a nonspecific band or a special version of this protein in 293T cells.

• Applications: Western Blot