Tested Applications
| Positive WB detected in | human lung tissue, mouse kidney tissue, Human peripheral blood leukocyte cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11822-1-AP targets VAMP5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2390 Product name: Recombinant human VAMP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC017891 Sequence: MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN Predict reactive species |
| Full Name | vesicle-associated membrane protein 5 (myobrevin) |
| Calculated Molecular Weight | 12.8 kDa |
| Observed Molecular Weight | 13-15 kDa |
| GenBank Accession Number | BC017891 |
| Gene Symbol | VAMP5 |
| Gene ID (NCBI) | 10791 |
| RRID | AB_2212965 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95183 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP5, also known as myobrevin, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP5 may participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for VAMP5 antibody 11822-1-AP | Download protocol |
| WB protocol for VAMP5 antibody 11822-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VAMP5 Polyclonal antibody (Cat# 11822-1-AP) has 5 total citations. These appear in Nature Communications, Frontiers in Immunology, Scientific Reports, Frontiers in Molecular Neuroscience, and Journal of Neuro-Oncology. The research fields span coronavirus defense in embryonic stem cells, glioma immune microenvironment and prognosis, exosome-related gene diagnosis in hepatocellular carcinoma, SNARE protein risk modeling in gliomas, and VAMP5-targeted glioma growth suppression. Applications cited include WB, IHC, and IF in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Nat Commun Vesicle-associated membrane protein 5 is an intrinsic defense factor for embryonic stem cells against coronaviruses
| ||
Front Immunol Immune Gene Signatures and Immunotypes in Immune Microenvironment Are Associated With Glioma Prognose. | ||
Sci Rep Predictive effect and clinical diagnosis significance of exosome-related genes for nonalcoholic fatty liver disease-related hepatocellular carcinoma. | ||
Front Mol Neurosci Construction and validation of a risk model based on the key SNARE proteins to predict the prognosis and immune microenvironment of gliomas | ||
J Neurooncol Targeting VAMP5 suppresses PLK1-driven growth of gliomas with high NDRG4 expression. |
Reviews
What customers say
Customer reviews for this antibody are mixed. One user rated it 5 stars, reporting that it worked well in Western blot at the supplier-recommended 1/1000 dilution in Jurkat cells. Another user gave it 3 stars, noting that it labeled a ~25 kD band but not a 15 kD band in 293T cell lysate, and was unsure whether this represented nonspecific binding or a distinct protein variant. Overall, the antibody performs reliably in Western blot, though one reviewer observed unexpected banding patterns in certain cell lines.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jean-Baptiste (Verified Customer) (09-13-2026) | The antibody works at the dilution specified by the supplier in a Western blot
|
Boyan (Verified Customer) (06-19-2020) | This antibody labels a ~ 25 kD band, but not a 15 kD band, in 293T cell lysate - not sure is this a nonspecific band or a special version of this protein in 293T cells.
|
