Tested Applications
| Positive WB detected in | human lung tissue, mouse kidney tissue, Human peripheral blood leukocyte cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11822-1-AP targets VAMP5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2390 Product name: Recombinant human VAMP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC017891 Sequence: MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN Predict reactive species |
| Full Name | vesicle-associated membrane protein 5 (myobrevin) |
| Calculated Molecular Weight | 12.8 kDa |
| Observed Molecular Weight | 13-15 kDa |
| GenBank Accession Number | BC017891 |
| Gene Symbol | VAMP5 |
| Gene ID (NCBI) | 10791 |
| RRID | AB_2212965 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95183 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP5, also known as myobrevin, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP5 may participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for VAMP5 antibody 11822-1-AP | Download protocol |
| WB protocol for VAMP5 antibody 11822-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Front Immunol Immune Gene Signatures and Immunotypes in Immune Microenvironment Are Associated With Glioma Prognose. | ||
Sci Rep Predictive effect and clinical diagnosis significance of exosome-related genes for nonalcoholic fatty liver disease-related hepatocellular carcinoma. | ||
Nat Commun Vesicle-associated membrane protein 5 is an intrinsic defense factor for embryonic stem cells against coronaviruses
| ||
Front Mol Neurosci Construction and validation of a risk model based on the key SNARE proteins to predict the prognosis and immune microenvironment of gliomas | ||
J Neurooncol Targeting VAMP5 suppresses PLK1-driven growth of gliomas with high NDRG4 expression. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boyan (Verified Customer) (06-19-2020) | This antibody labels a ~ 25 kD band, but not a 15 kD band, in 293T cell lysate - not sure is this a nonspecific band or a special version of this protein in 293T cells.
|
