VAMP5 Polyclonal antibody

VAMP5 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 11822-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Myobrevin, VAMP 5, VAMP5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman lung tissue, mouse kidney tissue, Human peripheral blood leukocyte cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11822-1-AP targets VAMP5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2390

Product name: Recombinant human VAMP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-116 aa of BC017891

Sequence: MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

Predict reactive species
Full Name vesicle-associated membrane protein 5 (myobrevin)
Calculated Molecular Weight 12.8 kDa
Observed Molecular Weight 13-15 kDa
GenBank Accession NumberBC017891
Gene Symbol VAMP5
Gene ID (NCBI) 10791
RRIDAB_2212965
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95183
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAMP5, also known as myobrevin, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP5 may participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.

Protocols

Product Specific Protocols
IHC protocol for VAMP5 antibody 11822-1-APDownload protocol
WB protocol for VAMP5 antibody 11822-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Front Immunol

Immune Gene Signatures and Immunotypes in Immune Microenvironment Are Associated With Glioma Prognose.

Authors - Xiang-Xu Wang
humanWB

Front Mol Neurosci

Construction and validation of a risk model based on the key SNARE proteins to predict the prognosis and immune microenvironment of gliomas

Authors - Luxin Yin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boyan (Verified Customer) (06-19-2020)

This antibody labels a ~ 25 kD band, but not a 15 kD band, in 293T cell lysate - not sure is this a nonspecific band or a special version of this protein in 293T cells.

  • Applications: Western Blot
Loading...
||
New chat Able
正在加载,请稍候...