VAPB Monoclonal antibody, PBS Only

Name: VAPB Monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 66191-1-PBS-100UG

VAPB Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66191-1-PBS

Clone No. 4F6A6

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

4F6A6, ALS8, UNQ484/PRO983, VAMP associated protein B/C, VAMP B

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis of HepG2 using 66191-1-Ig (same clone as 66191-1-PBS)
WB result of VAPB antibody (66191-1-Ig, 1:5000) with si-control and si-VAPB transfected HepG2 cells. This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 66191-1-Ig (same clone as 66191-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66191-1-Ig (VAPB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 66191-1-Ig (same clone as 66191-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66191-1-Ig (VAPB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 66191-1-Ig (same clone as 66191-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66191-1-Ig (VAPB Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 66191-1-Ig (same clone as 66191-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66191-1-Ig (VAPB Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 66191-1-Ig (same clone as 66191-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66191-1-Ig (VAPB antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 66191-1-Ig (same clone as 66191-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using VAPB antibody (66191-1-Ig, Clone: 4F6A6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 66191-1-Ig (same clone as 66191-1-PBS)
Immunofluorescent analysis of HepG2 cells using 66191-1-Ig (VAPB antibody) at dilution of 1:50 and Rhodamine-Goat anti-Mouse IgG. This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 66191-1-Ig (same clone as 66191-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using VAPB antibody (66191-1-Ig, Clone: 4F6A6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of U2OS using 66191-1-Ig (same clone as 66191-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed U2OS cells using VAPB antibody (66191-1-Ig, Clone: 4F6A6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for VAPB in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66191-1-PBS targets VAPB in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag6313 Product name: Recombinant human VAPB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 31-180 aa of BC001712 Sequence: KLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV Predict reactive species
Full Name	VAMP (vesicle-associated membrane protein)-associated protein B and C
Calculated Molecular Weight	27 kDa
Observed Molecular Weight	30-32 kDa
GenBank Accession Number	BC001712
Gene Symbol	VAPB
Gene ID (NCBI)	9217
RRID	AB_2881586
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	O95292
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Vesicle-associated membrane protein-associated protein B (VAPB) is an integral membrane protein localized to the endoplasmic reticulum (ER) membrane. VAPB has been implicated in various cellular processes, including ER stress, the unfolded protein response (UPR) and calcium homeostasis regulation. The mutations in the gene of VAPB cause amyotrophic lateral sclerosis 8 (ALS8) and some other related forms of motor neuron disease including late onset spinal muscular atrophy.