VAPB Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• VAPB Recombinant monoclonal antibody, PBS Only (87770-3-PBS)

VAPB Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 87770-3-PBS

Clone No.253359F2

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ALS8, UNQ484/PRO983, VAMP associated protein B/C, VAMP B, VAMP B/VAMP C

• 

  WB analysis using 87770-3-RR (same clone as 87770-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87770-3-RR (VAPB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87770-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 87770-3-RR (same clone as 87770-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 87770-3-RR (VAPB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87770-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 87770-3-RR (same clone as 87770-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 87770-3-RR (VAPB antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87770-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87770-3-PBS targets VAPB in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5857

  Product name: Recombinant human VAPB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-180 aa of BC001712

  Sequence: KLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV

• Full Name: VAMP (vesicle-associated membrane protein)-associated protein B and C
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC001712
• Gene Symbol: VAPB
• Gene ID (NCBI): 9217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95292
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vesicle-associated membrane protein-associated protein B (VAPB) is an integral membrane protein localized to the endoplasmic reticulum (ER) membrane. VAPB has been implicated in various cellular processes, including ER stress, the unfolded protein response (UPR), and calcium homeostasis regulation. The mutations in the gene of VAPB cause amyotrophic lateral sclerosis 8 (ALS8) and some other related forms of motor neuron disease, including late-onset spinal muscular atrophy.