VASH1 Polyclonal antibody

• 

  WB analysis of human brain using 12730-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12730-1-AP (VASH1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 12730-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 12730-1-AP (VASH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12730-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12730-1-AP (VASH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 12730-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using VASH1 antibody (12730-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

VASH1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 12730-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF/ICC, ELISA

Synonyms

Tyrosine carboxypeptidase 1, Tubulinyl-Tyr carboxypeptidase 1, Tubulin carboxypeptidase 1, TTCP 1, KIAA1036

---

Tested Applications

• Positive WB detected in: human brain tissue, HeLa cells, MCF-7 cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below
• IF: See 1 publications below

Product Information

12730-1-AP targets VASH1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3435

  Product name: Recombinant human VASH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-204 aa of BC009031

  Sequence: MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG

• Full Name: vasohibin 1
• Calculated Molecular Weight: 365 aa, 41 kDa
• Observed Molecular Weight: 36 and 41 kDa
• GenBank Accession Number: BC009031
• Gene Symbol: VASH1
• Gene ID (NCBI): 22846
• RRID: AB_2288318
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L8A9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VASH1, also named as vasohibin 1, is a angiogenesis inhibitor induced by the stimulation with VEGF. High expression of VASH1 has been researched in some tumors as a result of VEGF induction. It has been suggested that VASH-1 is clinically significant in bladder cancer, colorectal cancer and NSCLC. VASH-1 may be a potential marker of gastric cancer and a target for vascular targeting therapy. 12730-1-AP detects 41 kDa form secreted protein and 36 kDa form protein accumulated within the cells or pericellular milieu in SDS-PAGE.(PMID:19057892, 29042936, 29552154, 26666821)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
zebrafish	WB	Development; Vasohibin 1 selectively regulates secondary sprouting and lymphangiogenesis in the zebrafish trunk.; Authors - Marta Bastos de Oliveira ; KO Validated
	WB	Cell Rep; Augmin-dependent microtubule self-organization drives kinetochore fiber maturation in mammals.; Authors - Ana C Almeida ; KD Validated
mouse	IF	Neuron; MicroRNA mechanisms instructing Purkinje cell specification; Authors - Norjin Zolboot