Use Able AI chat for product recommendations

VASN Polyclonal antibody

VASN Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 17714-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Protein slit like 2, Protein slit-like 2, SLITL2, UNQ314/PRO357/PRO1282, Vasorin

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, rat kidney tissue
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17714-1-AP targets VASN in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12040

Product name: Recombinant human VASN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-349 aa of BC068575

Sequence: GCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNSLLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRGLTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC

Predict reactive species
Full Name vasorin
Calculated Molecular Weight 673 aa, 72 kDa
Observed Molecular Weight50-60 kDa, 75 kDa, 100 kDa
GenBank Accession NumberBC068575
Gene Symbol VASN
Gene ID (NCBI) 114990
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6EMK4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vasorin (VASN) is a single transmembrane type I membrane protein, also known as Slit-like 2 protein (SLITL2). It is mainly expressed in vascular smooth muscle cells and participates in many pathophysiological processes. VASN contains an EGF-like domain, ten leucine-rich repeats (LRR) and a transmembrane domain. VASN is considered as a negative regulator of transforming growth factor -\(\beta \) (TGF-\(\beta \)) signal. It may be involved in regulating cell growth, differentiation and epithelial-mesenchymal transition (EMT) by binding and regulating the activity of TGF-\(\beta \). In blood vessels, VASN is expressed in vascular smooth muscle cells, which has the characteristics of protecting blood vessels and can negatively regulate cell migration and proliferation caused by vascular injury. VASN is also involved in the reaction of cells to hypoxia and redox state, and plays a certain role in alleviating cell stress damage. Because of its high expression in specific tissues (such as blood vessels and some solid tumors), VASN is often used as a molecular marker to study vascular diseases or pathological changes of tumors. The protein has multiple bands, intact vasorin (∼100 kDa) and a soluble fragment (∼75 kDa),Cleaved frament (~50-60 kDa) (PMID: 29930755).

Protocols

Product Specific Protocols
IF protocol for VASN antibody 17714-1-APDownload protocol
WB protocol for VASN antibody 17714-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Exp Cell Res

GLUT1 Maintains Esophageal Cancer Stem Cell-like Characteristics by Inhibiting Autophagy-dependent Ferroptosis via EGFR

Authors - Xin Sui
Loading...
||
New chat

Able

正在加载,请稍候...