VAV1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86933-2-RR (same clone as 86933-2-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 86933-2-RR (VAV1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86933-2-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 86933-2-RR (same clone as 86933-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using VAV1 antibody (86933-2-RR, Clone: 251870A5 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86933-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86933-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86933-2-RR against Human VAV1 were performed. The affinity constant is below 1 pM.

VAV1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86933-2-PBS

Clone No.251870A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Proto oncogene vav, Proto-oncogene vav, VAV

---

Product Information

86933-2-PBS targets VAV1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag38665

  Product name: Recombinant human VAV1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 442-790 aa of BC013361

  Sequence: EQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC

• Full Name: vav 1 guanine nucleotide exchange factor
• Calculated Molecular Weight: 845 aa, 98 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: BC013361
• Gene Symbol: VAV1
• Gene ID (NCBI): 7409
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15498
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vav proteins mainly act as enzymes that catalyze the activation step of Rho subfamily GTPases during cell signaling. There are three family members:VAV1, VAV2 and VAV3. Vav1 is specifically expressed in the hematopoietic system, whereas Vav2 and Vav3 are more ubiquitously expressed (PMID:14607270). Vav1 is physiologically active as a GDP/GTP nucleotide exchange factor (GEF) in the hematopoietic system (PMID:31654719).