Tested Applications
| Positive WB detected in | HEK-293 cells, mouse brain tissue, A431 cells, NIH/3T3 cells, HeLa cells, mouse liver tissue, rat liver tissue, SH-SY5Y cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human kidney tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
21924-1-AP targets VAV2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16458 Product name: Recombinant human VAV2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 98-326 aa of BC132967 Sequence: DLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVV Predict reactive species |
| Full Name | vav 2 guanine nucleotide exchange factor |
| Calculated Molecular Weight | 839 aa, 97 kDa |
| Observed Molecular Weight | 101 kDa |
| GenBank Accession Number | BC132967 |
| Gene Symbol | VAV2 |
| Gene ID (NCBI) | 7410 |
| RRID | AB_11182283 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52735 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAV2 is the second member of the VAV family of guanine nucleotide exchange factors (GEFs) for the Rho family of Ras-related GTPases. As a GEF, it catalyzes the conversion of Rho GTPases from an inactive GDP-bound state to an active GTP-bound state, thereby regulating critical cellular processes such as signal transduction, cytoskeletal remodeling, and cell migration. Unlike its family member VAV1, whose expression is restricted to hematopoietic cells, VAV2 is widely expressed across most tissues. It plays a particularly important role in angiogenesis, where its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Structurally, VAV2 contains Dbl homology (DH), Pleckstrin homology (PH), Src homology 2 (SH2), and Src homology 3 (SH3) domains, which are consistent with its function as both a signaling adaptor and an exchange factor.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VAV2 antibody 21924-1-AP | Download protocol |
| IHC protocol for VAV2 antibody 21924-1-AP | Download protocol |
| IP protocol for VAV2 antibody 21924-1-AP | Download protocol |
| WB protocol for VAV2 antibody 21924-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
FASEB J Mesenchymal stem cells promote endothelial progenitor cell migration, vascularization, and bone repair in tissue-engineered constructs via activating CXCR2-Src-PKL/Vav2-Rac1. | ||
Nat Commun Neutrophil extracellular traps-inspired DNA hydrogel for wound hemostatic adjuvant | ||
Life Sci Alliance Vav2 is a master regulator of repair against bacterial pore-forming toxins. | ||
J Nanobiotechnology Proangiogenic effect and underlying mechanism of holmium oxide nanoparticles: a new biomaterial for tissue engineering
| ||
Discov Oncol VAV2-associated ncRNA network in the focal adhesion pathway is dysregulated in laryngeal squamous cell carcinoma. |























