VAV2 Polyclonal antibody

• 

  WB analysis using 21924-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21924-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 21924-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 21924-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 21924-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 21924-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 21924-1-AP

  IP result of anti-VAV2 (IP:21924-1-AP, 4ug; Detection:21924-1-AP 1:2000) with HeLa cells lysate 1520 ug.

• 

  IHC staining of human pancreas using 21924-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 21924-1-AP (VAV2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas using 21924-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 21924-1-AP (VAV2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 21924-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 21924-1-AP (VAV2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 21924-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 21924-1-AP (VAV2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 21924-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using VAV2 antibody (21924-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

VAV2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21924-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

VAV-2, VAV 2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue, A431 cells, NIH/3T3 cells, HeLa cells, mouse liver tissue, rat liver tissue, SH-SY5Y cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human kidney tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

21924-1-AP targets VAV2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16458

  Product name: Recombinant human VAV2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 98-326 aa of BC132967

  Sequence: DLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVV

• Full Name: vav 2 guanine nucleotide exchange factor
• Calculated Molecular Weight: 839 aa, 97 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: BC132967
• Gene Symbol: VAV2
• Gene ID (NCBI): 7410
• RRID: AB_11182283
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52735
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	FASEB J; Mesenchymal stem cells promote endothelial progenitor cell migration, vascularization, and bone repair in tissue-engineered constructs via activating CXCR2-Src-PKL/Vav2-Rac1.; Authors - Zhilin Li
human	WB,IP,IF	J Nanobiotechnology; Proangiogenic effect and underlying mechanism of holmium oxide nanoparticles: a new biomaterial for tissue engineering; Authors - Yuxiao Luo ; KD Validated
	WB	Nat Commun; Neutrophil extracellular traps-inspired DNA hydrogel for wound hemostatic adjuvant; Authors - Rui Ye