VAV2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VAV2 Polyclonal antibody (21924-1-AP)

VAV2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21924-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

VAV 2, VAV-2

• 

  WB analysis using 21924-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21924-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 21924-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 21924-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 21924-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 21924-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 21924-1-AP (VAV2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 21924-1-AP

  IP result of anti-VAV2 (IP:21924-1-AP, 4ug; Detection:21924-1-AP 1:2000) with HeLa cells lysate 1520 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 21924-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 21924-1-AP (VAV2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 21924-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 21924-1-AP (VAV2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 21924-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 21924-1-AP (VAV2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 21924-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 21924-1-AP (VAV2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 21924-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using VAV2 antibody (21924-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue, A431 cells, NIH/3T3 cells, HeLa cells, mouse liver tissue, rat liver tissue, SH-SY5Y cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human kidney tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21924-1-AP targets VAV2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16458

  Product name: Recombinant human VAV2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 98-326 aa of BC132967

  Sequence: DLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVV

• Full Name: vav 2 guanine nucleotide exchange factor
• Calculated Molecular Weight: 839 aa, 97 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: BC132967
• Gene Symbol: VAV2
• Gene ID (NCBI): 7410
• RRID: AB_11182283
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52735
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAV2 is the second member of the VAV family of guanine nucleotide exchange factors (GEFs) for the Rho family of Ras-related GTPases. As a GEF, it catalyzes the conversion of Rho GTPases from an inactive GDP-bound state to an active GTP-bound state, thereby regulating critical cellular processes such as signal transduction, cytoskeletal remodeling, and cell migration. Unlike its family member VAV1, whose expression is restricted to hematopoietic cells, VAV2 is widely expressed across most tissues. It plays a particularly important role in angiogenesis, where its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Structurally, VAV2 contains Dbl homology (DH), Pleckstrin homology (PH), Src homology 2 (SH2), and Src homology 3 (SH3) domains, which are consistent with its function as both a signaling adaptor and an exchange factor.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	FASEB J; Mesenchymal stem cells promote endothelial progenitor cell migration, vascularization, and bone repair in tissue-engineered constructs via activating CXCR2-Src-PKL/Vav2-Rac1.; Authors - Zhilin Li
		Life Sci Alliance; Vav2 is a master regulator of repair against bacterial pore-forming toxins.; Authors - Victor Gbenga Kayejo
	WB	Nat Commun; Neutrophil extracellular traps-inspired DNA hydrogel for wound hemostatic adjuvant; Authors - Rui Ye
		Discov Oncol; VAV2-associated ncRNA network in the focal adhesion pathway is dysregulated in laryngeal squamous cell carcinoma.; Authors - Payam Mohammadi
human	WB,IP,IF	J Nanobiotechnology; Proangiogenic effect and underlying mechanism of holmium oxide nanoparticles: a new biomaterial for tissue engineering; Authors - Yuxiao Luo ; KD Validated