VAV2 Monoclonal antibody

• 

  WB analysis of fetal human brain using 67108-1-Ig

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 67108-1-Ig (VAV2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 67108-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67108-1-Ig (VAV2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 67108-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67108-1-Ig (VAV2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 67108-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67108-1-Ig (VAV2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 67108-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 67108-1-Ig (VAV2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67108-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67108-1-Ig (VAV2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 67108-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67108-1-Ig (VAV2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 67108-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using VAV2 antibody (67108-1-Ig, Clone: 3F11B5 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

• 

  IF Staining of HUVEC using 67108-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HUVEC cells using VAV2 antibody (67108-1-Ig, Clone: 3F11B5 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

• 

  IF Staining of HeLa using 67108-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using VAV2 antibody (67108-1-Ig, Clone: 3F11B5 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

VAV2 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67108-1-Ig

Clone No.3F11B5

Host / Isotype

Mouse / IgG2a

Reactivity

Human, pig, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

VAV 2, VAV2

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, A431 cells, HeLa cells, HEK-293 cells, pig brain tissue, rat brain tissue, mouse brain tissue
• Positive IF/ICC detected in: A431 cells, HeLa cells, HUVEC cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67108-1-Ig targets VAV2 in WB, IF/ICC, ELISA applications and shows reactivity with Human, pig, mouse, rat samples.

• Tested Reactivity: Human, pig, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17988

  Product name: Recombinant human VAV2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 98-326 aa of BC132967

  Sequence: DLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVV

• Full Name: vav 2 guanine nucleotide exchange factor
• Calculated Molecular Weight: 839 aa, 97 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: BC132967
• Gene Symbol: VAV2
• Gene ID (NCBI): 7410
• RRID: AB_2882412
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P52735
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.