VAV3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VAV3 Polyclonal antibody, PBS Only (30291-1-PBS)

• 

  WB analysis using 30291-1-AP (same clone as 30291-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30291-1-AP (VAV3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30291-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 30291-1-AP (same clone as 30291-1-PBS)

  IP result of anti-VAV3 (IP:30291-1-AP, 4ug; Detection:30291-1-AP 1:8000) with Jurkat cells lysate 1560 ug. This data was developed using the same antibody clone with 30291-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 30291-1-AP (same clone as 30291-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 30291-1-AP (VAV3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30291-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 30291-1-AP (same clone as 30291-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30291-1-AP (VAV3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30291-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 30291-1-AP (same clone as 30291-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 30291-1-AP (VAV3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30291-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30291-1-AP (same clone as 30291-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using VAV3 antibody (30291-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30291-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 30291-1-AP (same clone as 30291-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using VAV3 antibody (30291-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 30291-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 30291-1-AP (same clone as 30291-1-PBS)

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human VAV3 (30291-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 30291-1-PBS in a different storage buffer formulation.

VAV3 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 30291-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

Guanine nucleotide exchange factor VAV3, VAV 3

---

Product Information

30291-1-PBS targets VAV3 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33022

  Product name: Recombinant human VAV3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 546-847 aa of NM_006113

  Sequence: KCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE

• Full Name: vav 3 guanine nucleotide exchange factor
• Calculated Molecular Weight: 98kd
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: NM_006113
• Gene Symbol: VAV3
• Gene ID (NCBI): 10451
• RRID: AB_3086288
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKW4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vav3, a member of Dbl family which is also the activator of GTP kinase of Rho family, can activate the expression of RhoA, Racl and Cdc42 (PMID:28285969). Vav3 is associated with tumor growth, apoptosis, invasion, metastasis and angiogenesis (PMID:28285969). Vav3 is a multiple function protein with both signaling molecule and coactivator activities. Vav3 oncogene is overexpressed in androgen-independent prostate cancer cells relative to their androgen-dependent counterparts and contribute to development of hormone refractory prostate cancer (PMID:21455584).