VAV3 Polyclonal antibody

• 

  WB analysis using 30291-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30291-1-AP (VAV3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 30291-1-AP

  IP result of anti-VAV3 (IP:30291-1-AP, 4ug; Detection:30291-1-AP 1:8000) with Jurkat cells lysate 1560 ug.

• 

  IHC staining of human colon cancer using 30291-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 30291-1-AP (VAV3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 30291-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using VAV3 antibody (30291-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of Jurkat using 30291-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using VAV3 antibody (30291-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• 

  FC experiment of Jurkat using 30291-1-AP

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human VAV3 (30291-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

VAV3 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 30291-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Guanine nucleotide exchange factor VAV3, VAV 3

---

Tested Applications

• Positive WB detected in: Jurkat cells, THP-1 cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Jurkat cells, HeLa cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

30291-1-AP targets VAV3 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33022

  Product name: Recombinant human VAV3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 546-847 aa of NM_006113

  Sequence: KCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE

• Full Name: vav 3 guanine nucleotide exchange factor
• Calculated Molecular Weight: 98kd
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: NM_006113
• Gene Symbol: VAV3
• Gene ID (NCBI): 10451
• RRID: AB_3086288
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKW4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vav3, a member of Dbl family which is also the activator of GTP kinase of Rho family, can activate the expression of RhoA, Racl and Cdc42 (PMID:28285969). Vav3 is associated with tumor growth, apoptosis, invasion, metastasis and angiogenesis (PMID:28285969). Vav3 is a multiple function protein with both signaling molecule and coactivator activities. Vav3 oncogene is overexpressed in androgen-independent prostate cancer cells relative to their androgen-dependent counterparts and contribute to development of hormone refractory prostate cancer (PMID:21455584).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	CNS Neurosci Ther; Identification of Brain Cell Type-Specific Therapeutic Targets for Glioma From Genetics; Authors - Jiawei Gui
	WB	Nat Commun; Neutrophil extracellular traps-inspired DNA hydrogel for wound hemostatic adjuvant; Authors - Rui Ye