Use Able AI chat for product recommendations

VEGFA Recombinant monoclonal antibody, PBS Only

VEGFA Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 81323-2-PBS
Clone No. 7H10
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

VEGF, L-VEGF, N-VEGF, Vascular Endothelial Growth Factor, vascular endothelial growth factor A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for VEGFA in ?

Product Information

81323-2-PBS targets VEGFA in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13500

Product name: Recombinant human VEGFA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-302 aa of BC065522

Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Predict reactive species
Full Name vascular endothelial growth factor A
Calculated Molecular Weight 412 aa, 46 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberBC065522
Gene Symbol VEGFA
Gene ID (NCBI) 7422
RRIDAB_3086457
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15692
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

VEGFA, also named as VEGF or VPF, belongs to the PDGF/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are associated with microvascular complications of diabetes type 1 (MVCD1). VEGFA has 17 isoforms with MW from 16 to 45 kDa. Some isoforms have homodimer forms (e.g.; VEGFA189 38 kDa or VEFGA110 34 kDa). VEGF-A exists in at least seven homodimeric isoforms. The monomers consist of 121, 145, 148, 165, 183, 189, or 206 amino acids (PMID:15602010 ).

Loading...
||
New chat

Able™

正在加载,请稍候...