VEGFA Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81323-2-RR (same clone as 81323-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81323-2-RR (VEGFA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81323-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 81323-2-RR (same clone as 81323-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using VEGFA antibody (81323-2-RR, Clone: 7H10 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 81323-2-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 81323-2-RR (same clone as 81323-2-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using VEGFA antibody (81323-2-RR, Clone: 7H10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 81323-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81323-2-RR

  Biolayer interferometry (BLl) kinetic assays of 81323-2-RR against Human VEGFA were performed. The affinity constant is 1.60 nM.

VEGFA Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 81323-2-PBS

Clone No.7H10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

VEGF, 7H10, L-VEGF, N-VEGF, Vascular Endothelial Growth Factor

---

Product Information

81323-2-PBS targets VEGFA in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13500

  Product name: Recombinant human VEGFA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-302 aa of BC065522

  Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

• Full Name: vascular endothelial growth factor A
• Calculated Molecular Weight: 412 aa, 46 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC065522
• Gene Symbol: VEGFA
• Gene ID (NCBI): 7422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15692
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VEGFA, also named as VEGF or VPF, belongs to the PDGF/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are associated with microvascular complications of diabetes type 1 (MVCD1). VEGFA has 17 isoforms with MW from 16 to 45 kDa. Some isoforms have homodimer forms (e.g.; VEGFA189 38 kDa or VEFGA110 34 kDa). VEGF-A exists in at least seven homodimeric isoforms. The monomers consist of 121, 145, 148, 165, 183, 189, or 206 amino acids (PMID:15602010 ).