VEGF-C Recombinant monoclonal antibody, PBS Only

• 

VEGF-C Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83727-1-PBS

Clone No.240772A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

VEGFC, vascular endothelial growth factor C, Vascular endothelial growth factor-related protein, VEGF C

---

Product Information

83727-1-PBS targets VEGF-C in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg32025

  Product name: Recombinant Human VEGFC protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 103-227 aa of BC035212

  Sequence: TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

• Full Name: vascular endothelial growth factor C
• Calculated Molecular Weight: 419 aa, 47 kDa
• GenBank Accession Number: BC035212
• Gene Symbol: VEGFC
• Gene ID (NCBI): 7424
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49767
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.