VGLUT2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VGLUT2 Polyclonal antibody (29209-1-AP)

VGLUT2 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, ELISA

Cat No. 29209-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, ELISA

Synonyms

SLC17A6, Differentiation-associated BNPI, Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter, DNPI

• 

  WB analysis using 29209-1-AP

  unboiled mouse brain tissue were subjected to SDS PAGE followed by western blot with 29209-1-AP (VGLUT2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 29209-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29209-1-AP (VGLUT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 29209-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29209-1-AP (VGLUT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 29209-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29209-1-AP (VGLUT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 29209-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using VGLUT2 antibody (29209-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 29209-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using VGLUT2 antibody (29209-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 29209-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using VGLUT2 antibody (29209-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 29209-1-AP

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using VGLUT2 antibody (29209-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for VGLUT2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: unboiled mouse brain tissue, unboiled rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue
• Positive IF-Fro detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29209-1-AP targets VGLUT2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29565

  Product name: Recombinant human SLC17A6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 499-582 aa of NM_020346

  Sequence: SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS

• Full Name: solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: NM_020346
• Gene Symbol: VGLUT2
• Gene ID (NCBI): 57084
• RRID: AB_3086104
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2U8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VGLUT2, also known as SLC17A6, belongs to the major facilitator superfamily. VGLUT2 is a multifunctional transporter that transports phosphate at the plasma membrane and glutamate in synaptic vesicles (PMID:33440152, 11432869). VGLUT2 is involved in neurotransmitter loading into synaptic vesicles (PMID: 11698620). VGLUT2 is predominantly expressed in adult and fetal brain, with highest expression in the medulla, substantia nigra, subthalamic nucleus, and thalamus, and low levels in the cerebellum and hippocampus (PMID:10820226).

Publications

What published studies show

The VGLUT2 Polyclonal antibody (Cat# 29209-1-AP) has 8 total citations. These appear in journals including Cell, Research, Biomaterials Research, International Immunopharmacology, Journal of Neurochemistry, Brain Research Bulletin, and Science China Life Sciences. The research fields span neuroscience and neurobiology, covering topics such as glutamatergic neuron aging, reward behavior, spinal cord injury regeneration, postoperative cognitive dysfunction, pain mechanisms, impulsive behavior, hypoxic-ischemic encephalopathy, and neuronal tissueoid integration.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Cell; Skin-innervating glutamatergic neurons modulate aging; Authors - Zhikai Wang ; KD Validated
mouse	IF	Research (Wash D C); Single-Cell Profiling Identifies Reward Behavior-Related Neurons and Alterations in the Ventral Tegmental Area Based on Arvcf-Knockout Mouse Model.; Authors - Meidi Zhang
		Biomater Res; Targeting Interleukin-6 Signaling with Reactive-Oxygen-Species-Responsive Hydrogel to Promote Regeneration after Spinal Cord Injury.; Authors - Runlin Wen
mouse	WB	Int Immunopharmacol; Ginsenoside 1 mitigates postoperative cognitive dysfunction by enhancing microglial Aβ clearance through the endo-lysosomal pathway; Authors - Xu Jing
rat	WB,IF	Int Immunopharmacol; Rutin alleviates preoperative anxiety stress-induced persistent postoperative pain by inhibiting microglia-mediated abnormal synaptic engulfment in the spinal cord dorsal horn.; Authors - Yufeng Zhang
mouse	WB,IF	J Neurochem; Adiphenine Alleviates Impulsive-Like Behaviors in Aged Mice by Inhibiting Nicotinic Acetylcholine Receptors.; Authors - Heng-Yue Peng