Anti-Mouse VISTA Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse VISTA Rabbit Recombinant Antibody (98487-2-RR)

VISTA Uni-rAb^® Recombinant Antibody for FC

Cat No. 98487-2-RR Copied!

Clone No. 250122B7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Dies1, PD-1H, Platelet receptor Gi24, V-set domain-containing immunoregulatory receptor, V-set immunoregulatory receptor

• 

  FC experiment of mouse splenocytes using 98487-2-RR

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse VISTA Rabbit RecAb (98487-2-RR, Clone: 250122B7) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-conjugated Goat Anti-Rabbit IgG. Cells were then stained with CoraLite® Plus 488 Anti-Mouse CD8a. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using 98487-2-RR

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse VISTA Rabbit RecAb (98487-2-RR, Clone:250122B7) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-conjugated Goat Anti-Rabbit IgG. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for VISTA in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98487-2-RR targets VISTA in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2809

  Product name: Recombinant Mouse VISTA protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 33-191 aa of NM_001159572.1

  Sequence: FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA

• Full Name: RIKEN cDNA 4632428N05 gene
• Calculated Molecular Weight: 34 kDa
• GenBank Accession Number: NM_001159572.1
• Gene Symbol: 4632428N05Rik
• Gene ID (NCBI): 74048
• RRID: AB_3746117
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9D659
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

VISTA, also known as platelet receptor Gi24, B7-H5, C10orf54, Dies1, PD-1H, and SISP1, is a member of the immunoglobulin superfamily. It serves not only as a positive regulator but also as a substrate of MT1-MMP and contributes at least in part to tumor invasion.