VLGR1 Polyclonal antibody

VLGR1 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 31628-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

ADGRV1, GPR98, ADGRV1 subunit alpha, ADGRV1 subunit beta, Adhesion G-protein coupled receptor V1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, SH-SY5Y cells
Positive IP detected inSH-SY5Y cells
Positive IHC detected inhuman lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31628-1-AP targets VLGR1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag34635

Product name: Recombinant human ADGRV1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2269-2812 aa of NM_032119

Sequence: ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA

Predict reactive species
Full Name G protein-coupled receptor 98
Calculated Molecular Weight693 kDa
Observed Molecular Weight217 kDa
GenBank Accession NumberNM_032119
Gene Symbol GPR98
Gene ID (NCBI) 84059
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ8WXG9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VLGR1 (very large G protein-coupled receptor-1), also known as ADGRV1, GPR98, and MASS, has a molecular weight of up to 700 kDa, making it the largest member of the 33 adhesive G protein-coupled receptors (ADGRs), a unique subfamily of the GPCR superfamily. The full-length VLGR1 encompasses ∼6300 amino acids and thus is difficult to analyze by electrophoresis. Vlgr1 is a core component of ankle-link complex in inner ear hair cells. Knock-out and mutation mouse models show that loss of Vlgr1 function leads to abnormal stereociliary development and hearing loss, indicating crucial roles of Vlgr1 in hearing transduction or auditory system development (PMID: 23180093). Western blot analysis detected VLGR1a isoform at an apparent molecular mass of 217 kDa .

Protocols

Product Specific Protocols
IHC protocol for VLGR1 antibody 31628-1-APDownload protocol
IP protocol for VLGR1 antibody 31628-1-APDownload protocol
WB protocol for VLGR1 antibody 31628-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...