VPS13D Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VPS13D Polyclonal antibody (29387-1-AP)

• 

  WB analysis using 29387-1-AP

  HeLa cells were subjected to Tris-Acetate gel system followed by western blot with 29387-1-AP (VPS13D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 29387-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 29387-1-AP (VPS13D antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 29387-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using VPS13D antibody (29387-1-AP) at dilution of 1:200 and Cy3-conjugated Affinipure Goat Anti-Rabbit IgG(H+L).

VPS13D Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29387-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Intermembrane lipid transfer protein VPS13D, KIAA0453, Vacuolar protein sorting-associated protein 13D

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

29387-1-AP targets VPS13D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29933

  Product name: Recombinant human VPS13D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4202-4388 aa of NM_015378

  Sequence: DFASETAQAVRDTATLSGPRTQAQRVRKPRCCTGPQGLLPRYSESQAEGQEQLFKLTDNIQDEFFIAVENIDSYCVLISSKAVYFLKSGDYVDREAIFLEVKYDDLYHCLVSKDHGKVYVQVTKKAVSTSSGVSIPGPSHQKPMVHVKSEVLAVKLSQEINYAKSLYYEQQLMLRLSENREQLELDS

• Full Name: vacuolar protein sorting 13 homolog D (S. cerevisiae)
• Calculated Molecular Weight: 492 kDa
• Observed Molecular Weight: ~500 kDa
• GenBank Accession Number: NM_015378
• Gene Symbol: VPS13D
• Gene ID (NCBI): 55187
• RRID: AB_3086126
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5THJ4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VPS13 (vacuolar protein sorting 13 ) acts at membrane contact sites between intracellular organelles to transport lipids. There are four VPS13 family members in human - VPS13A, VPS13B, VPS13C and VPS13D. Mutations in human VPS13 genes are linked to rare neurodegenerative disorders: chorea- acanthocytosis (VPS13A), Cohen syndrome (VPS13B), predispose to early onset into Parkinson disease (VPS13C) and lead to ataxia/spastic paraplegia (VPS13D) (PMID: 30656912).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; RHOA regulates mitochondria-ER contact sites through modulation of the VAPB/PTPIP51 tether.; Authors - Zheng Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Lauren (Verified Customer) (11-12-2024)

Tested different dilutions of the antibody to determine which dilution resulted in the best stain index and this was the 1:200 dilution when using flow cytometry

• Applications: Flow Cytometry
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: KG1a

VPS13D Antibody Flow Cytometry validation (1:200 dilution) in KG1a (Cat no:29387-1-AP)