VPS18 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VPS18 Polyclonal antibody, PBS Only (10901-1-PBS)

• 

  WB analysis of mouse brain using 10901-1-AP (same clone as 10901-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10901-1-AP (VPS18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 10901-1-AP (same clone as 10901-1-PBS)

  IP result of anti-VPS18 (IP:10901-1-AP, 4ug; Detection:10901-1-AP 1:300) with HeLa cells lysate 920ug. This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10901-1-AP (same clone as 10901-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10901-1-AP (VPS18 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10901-1-AP (same clone as 10901-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10901-1-AP (VPS18 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10901-1-AP (same clone as 10901-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10901-1-AP (VPS18 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10901-1-AP (same clone as 10901-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10901-1-AP (VPS18 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10901-1-AP (same clone as 10901-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10901-1-AP (VPS18 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10901-1-AP (same clone as 10901-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10901-1-AP (VPS18 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 10901-1-AP (same clone as 10901-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10901-1-AP (VPS18 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 10901-1-AP (same clone as 10901-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10901-1-AP (VPS18 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 10901-1-AP (same clone as 10901-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using VPS18 antibody (10901-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10901-1-PBS in a different storage buffer formulation.

VPS18 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10901-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Vacuolar protein sorting-associated protein 18 homolog, KIAA1475, hVPS18

---

Product Information

10901-1-PBS targets VPS18 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1140

  Product name: Recombinant human VPS18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 226-355 aa of BC001513

  Sequence: QRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVL

• Full Name: vacuolar protein sorting 18 homolog (S. cerevisiae)
• Calculated Molecular Weight: 110 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC001513
• Gene Symbol: VPS18
• Gene ID (NCBI): 57617
• RRID: AB_2273089
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P253
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Vps18 is a central member of Vps-C complex. Vps18 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.