Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

VPS25 Polyclonal antibody

VPS25 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA

hVps25, ESCRT-II complex subunit VPS25, ELL-associated protein of 20 kDa, EAP20, DERP9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for VPS25 in ?

Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, human brain tissue, mouse liver tissue, A549 cells, rat liver tissue, mouse brain tissue
Positive IHC detected inhuman breast cancer tissue, mouse brain tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15669-1-AP targets VPS25 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig, canine, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8134

Product name: Recombinant human VPS25 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-176 aa of BC006282

Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

Predict reactive species
Full Name vacuolar protein sorting 25 homolog (S. cerevisiae)
Calculated Molecular Weight 176 aa, 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC006282
Gene Symbol VPS25
Gene ID (NCBI) 84313
RRIDAB_2215019
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BRG1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VPS25 is a component of the endosome-associated complex ESCRT-II (Endosomal Sorting Complexes Required for Transport protein II). ESCRT-II complex, composed of VPS25, VPS36, and SNF8, functions in sorting of ubiquitinated membrane proteins during endocytosis. ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. VPS25 is highly conserved. Human VPS25 gene maps to chromosome 17q21.31 and is expressed in a wide range of tissues (PMID: 16889659).

Protocols

Product Specific Protocols
IF protocol for VPS25 antibody 15669-1-APDownload protocol
IHC protocol for VPS25 antibody 15669-1-APDownload protocol
WB protocol for VPS25 antibody 15669-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The VPS25 Polyclonal antibody (Cat# 15669-1-AP) has 11 citations published in journals including Nature Cell Biology, Nature Communications, Science Advances, Current Biology, Journal of Cell Biology, Cancer Cell International, Frontiers in Microbiology, Biomolecules, PLoS Pathogens, and Journal of Virology. Research fields span ESCRT machinery function, membrane repair, microautophagy, viral replication (enterovirus, swine fever, PRRSV), exosome biogenesis, and cancer biology (glioma, head and neck squamous cell carcinoma).

SpeciesApplicationTitle
humanIF

Nat Cell Biol

Endosomal membrane tension regulates ESCRT-III-dependent intra-lumenal vesicle formation.

Authors - Vincent Mercier
mouseWB

Nat Commun

Mechanism of Ca²⁺-triggered ESCRT assembly and regulation of cell membrane repair.

Authors - Luana L Scheffer
human,mouseWB,IP

Sci Adv

Lipid-anchored proteasomes control membrane protein homeostasis

Authors - Ruizhu Zhang
  • KD Validated
canineWB

Curr Biol

A Septin Double Ring Controls the Spatiotemporal Organization of the ESCRT Machinery in Cytokinetic Abscission.

Authors - Eva P Karasmanis
human,mouseWB,IHC

Cancer Cell Int

YTHDC1-mediated VPS25 regulates cell cycle by targeting JAK-STAT signaling in human glioma cells.

Authors - Xiaolong Zhu
  • KD Validated
humanWB

J Cell Biol

VPS37A directs ESCRT recruitment for phagophore closure.

Authors - Yoshinori Takahashi

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Viviana H.) rated this product 5/5 stars. She used it on mouse embryonic tissue from wild-type and knockout mutants at a 1:1000 dilution for Western Blot and with 2 µg for Immunoprecipitation of endogenous protein. She reported it "works very well" for both applications and noted the antibody is KD-validated. Overall, the feedback is strongly positive, confirming reliable performance for WB and IP.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Viviana (Verified Customer) (04-27-2022)

It works very well for WB (1:1000, KD validated) and for IP (2 ug, endogenous protein).

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse embryonic tissue isolated from wild type and KD mutantss
Loading...
||
New chat

Able™

正在加载,请稍候...