VPS25 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VPS25 Polyclonal antibody (15669-1-AP)

• Featured Product
• KD/KO Validated

VPS25 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15669-1-AP Copied!

Publications (11)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

hVps25, ESCRT-II complex subunit VPS25, ELL-associated protein of 20 kDa, EAP20, DERP9

• 

  WB analysis of A549 using 15669-1-AP

  WB result of VPS25 antibody (15669-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-VPS25 transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15669-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15669-1-AP (VPS25 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15669-1-AP

  WB result of VPS25 antibody (15669-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-VPS25 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 15669-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15669-1-AP (VPS25 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 15669-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 15669-1-AP (VPS25 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15669-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15669-1-AP (VPS25 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 15669-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15669-1-AP (VPS25 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 15669-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15669-1-AP (VPS25 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 15669-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15669-1-AP (VPS25 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15669-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15669-1-AP (VPS25 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15669-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15669-1-AP (VPS25 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 15669-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15669-1-AP (VPS25 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 15669-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15669-1-AP (VPS25 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15669-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using VPS25 antibody (15669-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for VPS25 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, human brain tissue, mouse liver tissue, A549 cells, rat liver tissue, mouse brain tissue
• Positive IHC detected in: human breast cancer tissue, mouse brain tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15669-1-AP targets VPS25 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, canine, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8134

  Product name: Recombinant human VPS25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC006282

  Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

• Full Name: vacuolar protein sorting 25 homolog (S. cerevisiae)
• Calculated Molecular Weight: 176 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC006282
• Gene Symbol: VPS25
• Gene ID (NCBI): 84313
• RRID: AB_2215019
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRG1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VPS25 is a component of the endosome-associated complex ESCRT-II (Endosomal Sorting Complexes Required for Transport protein II). ESCRT-II complex, composed of VPS25, VPS36, and SNF8, functions in sorting of ubiquitinated membrane proteins during endocytosis. ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. VPS25 is highly conserved. Human VPS25 gene maps to chromosome 17q21.31 and is expressed in a wide range of tissues (PMID: 16889659).

Publications

What published studies show

The VPS25 Polyclonal antibody (Cat# 15669-1-AP) has 11 citations published in journals including Nature Cell Biology, Nature Communications, Science Advances, Current Biology, Journal of Cell Biology, Cancer Cell International, Frontiers in Microbiology, Biomolecules, PLoS Pathogens, and Journal of Virology. Research fields span ESCRT machinery function, membrane repair, microautophagy, viral replication (enterovirus, swine fever, PRRSV), exosome biogenesis, and cancer biology (glioma, head and neck squamous cell carcinoma).

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Cell Biol; Endosomal membrane tension regulates ESCRT-III-dependent intra-lumenal vesicle formation.; Authors - Vincent Mercier
mouse	WB	Nat Commun; Mechanism of Ca²⁺-triggered ESCRT assembly and regulation of cell membrane repair.; Authors - Luana L Scheffer
human,mouse	WB,IP	Sci Adv; Lipid-anchored proteasomes control membrane protein homeostasis; Authors - Ruizhu Zhang ; KD Validated
canine	WB	Curr Biol; A Septin Double Ring Controls the Spatiotemporal Organization of the ESCRT Machinery in Cytokinetic Abscission.; Authors - Eva P Karasmanis
human,mouse	WB,IHC	Cancer Cell Int; YTHDC1-mediated VPS25 regulates cell cycle by targeting JAK-STAT signaling in human glioma cells.; Authors - Xiaolong Zhu ; KD Validated
human	WB	J Cell Biol; VPS37A directs ESCRT recruitment for phagophore closure.; Authors - Yoshinori Takahashi

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

One reviewer (Viviana H.) rated this product 5/5 stars. She used it on mouse embryonic tissue from wild-type and knockout mutants at a 1:1000 dilution for Western Blot and with 2 µg for Immunoprecipitation of endogenous protein. She reported it "works very well" for both applications and noted the antibody is KD-validated. Overall, the feedback is strongly positive, confirming reliable performance for WB and IP.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Viviana (Verified Customer) (04-27-2022)

It works very well for WB (1:1000, KD validated) and for IP (2 ug, endogenous protein).

• Applications: Western Blot, Immunoprecipitation
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse embryonic tissue isolated from wild type and KD mutantss