VPS25 Monoclonal antibody, PBS Only

• 

  WB analysis using 68197-1-Ig (same clone as 68197-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68197-1-Ig (VPS25 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68197-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit kidney using 68197-1-Ig (same clone as 68197-1-PBS)

  rabbit kidney tissue were subjected to SDS PAGE followed by western blot with 68197-1-Ig (VPS25 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68197-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 68197-1-Ig (same clone as 68197-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 68197-1-Ig (VPS25 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68197-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68197-1-Ig (same clone as 68197-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using VPS25 antibody (68197-1-Ig, Clone: 3B4C3 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68197-1-PBS in a different storage buffer formulation.

VPS25 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68197-1-PBS

Clone No.3B4C3

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rabbit

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

DERP9, EAP20, ESCRT II complex subunit VPS25, FAP20, hVps25, VPS25

---

Product Information

68197-1-PBS targets VPS25 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Rabbit samples.

• Tested Reactivity: Human, Rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8243

  Product name: Recombinant human VPS25 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-176 aa of BC006282

  Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

• Full Name: vacuolar protein sorting 25 homolog (S. cerevisiae)
• Calculated Molecular Weight: 176 aa, 21 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC006282
• Gene Symbol: VPS25
• Gene ID (NCBI): 84313
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BRG1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VPS25 is a component of the endosome-associated complex ESCRT-II (Endosomal Sorting Complexes Required for Transport protein II). ESCRT-II complex, composed of VPS25, VPS36, and SNF8, functions in sorting of ubiquitinated membrane proteins during endocytosis. ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. VPS25 is highly conserved. Human VPS25 gene maps to chromosome 17q21.31 and is expressed in a wide range of tissues (PMID: 16889659).