Use Able AI chat for product recommendations

VPS25 Monoclonal antibody, PBS Only (Capture)

VPS25 Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 68197-1-PBS
Clone No.3B4C3

Host / Isotype

Mouse / IgG1

Reactivity

human, rabbit

Applications

WB, IF/ICC, Indirect ELISA

3B4C3, Dermal papilla-derived protein 9, DERP9, EAP20, ELL-associated protein of 20 kDa

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68197-1-PBS targets VPS25 as part of a matched antibody pair:

MP51765-1: 68197-1-PBS capture and 68197-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8243

Product name: Recombinant human VPS25 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-176 aa of BC006282

Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

Predict reactive species
Full Name vacuolar protein sorting 25 homolog (S. cerevisiae)
Calculated Molecular Weight 176 aa, 21 kDa
Observed Molecular Weight19 kDa
GenBank Accession NumberBC006282
Gene Symbol VPS25
Gene ID (NCBI) 84313
RRIDAB_2935286
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BRG1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

VPS25 is a component of the endosome-associated complex ESCRT-II (Endosomal Sorting Complexes Required for Transport protein II). ESCRT-II complex, composed of VPS25, VPS36, and SNF8, functions in sorting of ubiquitinated membrane proteins during endocytosis. ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. VPS25 is highly conserved. Human VPS25 gene maps to chromosome 17q21.31 and is expressed in a wide range of tissues (PMID: 16889659).

Loading...
||
New chat

Able

正在加载,请稍候...