VPS33A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VPS33A Polyclonal antibody (16896-1-AP)

• Featured Product
• KD/KO Validated

VPS33A Polyclonal Antibody for WB, IP, ELISA

Cat No. 16896-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, CoIP, ELISA

Synonyms

Vacuolar protein sorting-associated protein 33A, hVPS33A

• 

  WB analysis of human brain using 16896-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16896-1-AP (VPS33A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 16896-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16896-1-AP (VPS33A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human cerebellum using 16896-1-AP

  human cerebellum tissue were subjected to SDS PAGE followed by western blot with 16896-1-AP (VPS33A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 16896-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16896-1-AP (VPS33A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 16896-1-AP

  IP result of anti-VPS33A (IP:16896-1-AP, 4ug; Detection:16896-1-AP 1:600) with HepG2 cells lysate 1600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for VPS33A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue, HepG2 cells, human cerebellum tissue, NIH/3T3 cells
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16896-1-AP targets VPS33A in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10422

  Product name: Recombinant human VPS33A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 246-596 aa of BC016617

  Sequence: YEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF

• Full Name: vacuolar protein sorting 33 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 596 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC016617
• Gene Symbol: VPS33A
• Gene ID (NCBI): 65082
• RRID: AB_2214916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AX1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VPS33A is a Sec1/Munc18 family member and is a component of the homotypic fusion and protein sorting (HOPS)-tethering complex. The mammalian HOPS complex comprises six subunits (VPS11, VPS16, VPS18, VPS33A, VPS39, and VPS41) (PMID: 23901104). This complex is required for late endosome-lysosome and autophagosome-lysosome fusion (PMID: 24554770). VPS33A plays a role in vesicular transport to the lysosomal compartment.

Publications

What published studies show

The VPS33A Polyclonal antibody (Cat# 16896-1-AP) has 18 citations across journals including Autophagy, Nature Communications, Theranostics, Cell Reports, Cell Death & Disease, Journal of Cell Biology, PLoS Pathogens, Archives of Toxicology, Journal of Hazardous Materials, Cell Systems, Virulence, Journal of Cell Science, Mammalian Genome, and Journal of Applied Genetics. Research fields encompass autophagosome-lysosome fusion, HOPS complex-mediated vesicle trafficking, endolysosomal biology, viral replication, neurotoxicology, glioblastoma, and mucopolysaccharidosis-plus syndrome.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; SDC1-dependent TGM2 determines radiosensitivity in glioblastoma by coordinating EPG5-mediated fusion of autophagosomes with lysosomes; Authors - Wang Zheng
human	WB	Autophagy; Acetylation of STX17 (syntaxin 17) controls autophagosome maturation.; Authors - Qiuhong Shen
human	WB,IP	Nat Commun; Deacetylated SNAP47 recruits HOPS to facilitate autophagosome-lysosome fusion independent of STX17; Authors - Fenglei Jian
human	WB	Nat Commun; C9orf72-catalyzed GTP loading of Rab39A enables HOPS-mediated membrane tethering and fusion in mammalian autophagy; Authors - Shen Zhang
human	CoIP	Theranostics; Histone H4K8 lactylation promotes glioblastoma progression by inducing NUPR1-mediated autophagosome‒lysosome fusion.; Authors - Jiangli Zhao
	WB	Cell Death Dis; Mutations in VPS18 lead to a neutrophil maturation defect associated with disturbed vesicle homeostasis.; Authors - Jincheng Gao