VPS35 Recombinant monoclonal antibody, PBS Only

VPS35 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 83328-2-PBS
Clone No.250521F1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

hVPS35, Maternal embryonic 3, Maternal-embryonic 3, MEM3, TCCCTA00141

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83328-2-PBS targets VPS35 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0333

Product name: Recombinant human VPS35 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC002414

Sequence: MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQ

Predict reactive species
Full Name vacuolar protein sorting 35 homolog (S. cerevisiae)
Calculated Molecular Weight 92 kDa
Observed Molecular Weight80-92 kDa
GenBank Accession NumberBC002414
Gene Symbol VPS35
Gene ID (NCBI) 55737
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96QK1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

VPS35 protein belongs to a group of vacuolar protein sorting (VPS) proteins, which ensure the proper delivery of organelle-specific proteins in eukaryotic cells. VPS35 is the core of a multimeric complex, termed the retromer complex, which is involved in retrograde transport of proteins from endosomes to the trans-Golgi network. Vps35 serves as the core of the multimeric complex by binding directly to Vps26 and Vps29 and SNX1. Northern blot analyses in 16 tissues showed that one transcript of Vps35 with a size of 3.6 kb was highly expressed in brain, heart, testis, ovary, small intestine, spleen, skeletal muscle, and placenta and expressed at moderate or low levels in other tissues. Another transcript of Vps35, a message of 3.0 kb, was also expressed with proportionally lower levels than the 3.6-kb transcript in all the tissues except that the 3.0-kb transcript was not detected in brain. Human Vps35 is mapped at 16q13-q21.

Loading...
||
New chat

Able

正在加载,请稍候...