VPS37B Polyclonal antibody

• 

  WB analysis of HeLa using 15653-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15653-1-AP (VPS37B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 15653-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 15653-1-AP (VPS37B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

VPS37B Polyclonal Antibody for WB, ELISA

Cat No. 15653-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

ESCRT I complex subunit VPS37B, hVps37B, VPS37B

---

Tested Applications

• Positive WB detected in: HeLa cells, COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 5 publications below

Product Information

15653-1-AP targets VPS37B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8256

  Product name: Recombinant human VPS37B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-285 aa of BC005882

  Sequence: MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ

• Full Name: vacuolar protein sorting 37 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC005882
• Gene Symbol: VPS37B
• Gene ID (NCBI): 79720
• RRID: AB_2878161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H9H4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; Removal of hypersignaling endosomes by simaphagy; Authors - Simona M Migliano ; KD Validated
mouse	WB	Autophagy Rep; Upregulation of the ESCRT pathway and multivesicular bodies accelerates degradation of proteins associated with neurodegeneration; Authors - Ron Benyair ; KD Validated
human	WB	EMBO J; Mammalian ATG8 proteins maintain autophagosomal membrane integrity through ESCRTs; Authors - Ruheena Javed ; KO Validated
human	WB	J Cell Sci; UMAD1 contributes to ESCRT-III dynamic subunit turnover during cytokinetic abscission; Authors - James Glover
human	WB	Bioorg Chem; Chemoproteomics reveals arctigenin as a phagophore-closure blocker via targeting ESCRT-I subunit VPS28; Authors - Jinyan Han