Tested Applications
| Positive WB detected in | U2OS cells, mouse kidney tissue, rat kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
34064-1-AP targets VPS9D1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag41163 Product name: Recombinant human C16orf7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 300-393 aa of BC148701 Sequence: YPAVSRAAAPAPGCCPPTPNPGSRRLRPSQSLHCMLSPPEPSAAPRPQDSPPTPPLQPGPVGSPSPLGDTASGLPDKDSSFEDLEQFLGTSERQ Predict reactive species |
| Full Name | chromosome 16 open reading frame 7 |
| Calculated Molecular Weight | 73 kDa |
| Observed Molecular Weight | 73 kDa |
| GenBank Accession Number | BC148701 |
| Gene Symbol | C16orf7 |
| Gene ID (NCBI) | 9605 |
| RRID | AB_3743148 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9Y2B5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VPS9 domain-containing protein 1 (VPS9D1) promotes tubular endosome formation by specifically activating Rab22A (PMID: 36762583). The long non-coding RNA VPS9D1-AS1 can be activated by CEBPB transcription factor and target VEGFA to activate its downstream pathway to promote colorectal cancer angiogenesis, which may suggest that VPS9D1-AS1 is critical for regulating colorectal cancer angiogenesis (PMID: 40371141).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for VPS9D1 antibody 34064-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

