VRK3 Polyclonal antibody

• 

  WB analysis using 15608-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15608-1-AP (VRK3 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15608-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15608-1-AP (VRK3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15608-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15608-1-AP (VRK3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 15608-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15608-1-AP (VRK3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 15608-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15608-1-AP (VRK3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

VRK3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15608-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

vaccinia related kinase 3, VRK3

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15608-1-AP targets VRK3 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7993

  Product name: Recombinant human VRK3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-301 aa of BC023556

  Sequence: MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENE

• Full Name: vaccinia related kinase 3
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 50-53 kDa
• GenBank Accession Number: BC023556
• Gene Symbol: VRK3
• Gene ID (NCBI): 51231
• RRID: AB_10863120
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IV63
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.