VSIG10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VSIG10 Polyclonal antibody (33200-1-AP)

• 

  WB analysis using 33200-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33200-1-AP ( VSIG10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 33200-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33200-1-AP ( VSIG10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

VSIG10 Polyclonal Antibody for WB, ELISA

Cat No. 33200-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

V-set and immunoglobulin domain-containing protein 10, VSIG10

---

Tested Applications

• Positive WB detected in: 786-O cells, rat liver tissue, ACHN cells, Calu-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33200-1-AP targets VSIG10 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37432

  Product name: Recombinant human FLJ20674 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-250 aa of BC034471

  Sequence: VVIGEVHENVTLHCGNISGLRGQVTWYRNNSEPVFLLSSNSSLRPAEPRFSLVDATSLHIESLSLGDEGIYTCQEILNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSSSRPPPVVEWWFQALNSSSESFGHNLTVNFFSLLLISPNLQGNYTCLALNQLSKRHRKVTTELLVYYPPPSAPQCWAQMASGSFMLQLTCRWDGG

• Full Name: hypothetical protein FLJ20674
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC034471
• Gene Symbol: FLJ20674
• Gene ID (NCBI): 54621
• RRID: AB_3742892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N0Z9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VSIG10 (V-set and immunoglobulin domain containing 10) is a protein-coding gene located on human chromosome 12q24.23 that encodes a transmembrane protein belonging to the immunoglobulin superfamily. VSIG10 is a protein whose expression is altered in response to SARS-CoV-2 infection, making it a novel candidate biomarker for COVID-19.