VSIG2 Polyclonal antibody

• 

  IHC staining of mouse stomach using 21056-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 21056-1-AP (VSIG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

VSIG2 Polyclonal Antibody for IHC, ELISA

Cat No. 21056-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

2210413P10Rik, CT like protein, CTH, CTXL, VSIG2

---

Tested Applications

• Positive IHC detected in: mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21056-1-AP targets VSIG2 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14342

  Product name: Recombinant human VSIG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-243 aa of BC007313

  Sequence: VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVA

• Full Name: V-set and immunoglobulin domain containing 2
• Calculated Molecular Weight: 327 aa, 34 kDa
• GenBank Accession Number: BC007313
• Gene Symbol: VSIG2
• Gene ID (NCBI): 23584
• RRID: AB_3669354
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96IQ7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VSIG2, also known as CTXL (cortical thymocyte-like protein), belongs to the V-Set and immunoglobulin (Ig) domain-containing (VSIG) family. The VSIG family is also a member of the immunoglobulin superfamily (IgSF). VSIG2 has been recognized as a novel immune checkpoint that plays a role in regulating immune response. VSIG2 was associated with the development and progression of colon adenocarcinoma (COAD) and pancreatic ductal adenocarcinoma (PDAC) and could be used as a potential biomarker(PMID: 34290531;PMID: 37626304).