VSTM2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VSTM2B Polyclonal antibody, PBS Only (33423-1-PBS)

• 

  WB analysis using 33423-1-AP (same clone as 33423-1-PBS)

  Fetal human brain tissue were subjected to SDS PAGE followed by western blot with 33423-1-AP (VSTM2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33423-1-PBS in a different storage buffer formulation.

VSTM2B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33423-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

V-set and transmembrane domain-containing protein 2B

---

Product Information

33423-1-PBS targets VSTM2B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg6734

  Product name: recombinant human VSTM2B protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 29-263 aa of NM_001146339.1

  Sequence: AFTEVPKDVTVREGDDIEMPCAFRASGATSYSLEIQWWYLKEPPRELLHELALSVPGARSKVTNKDATKISTVRVQGNDISHRLRLSAVRLQDEGVYECRVSDYSDDDTQEHKAQAMLRVLSRFAPPNMQAAEAVSHIQSSGPRRHGPASAANANNAGAASRTTSEPGRGDKSPPPGSPPAAIDPAVPEAAAASAAHTPTTTVAAAAAASSASPPSGQAVLLRQRHGSGTGRSYT

• Full Name: V-set and transmembrane domain containing 2B
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_001146339.1
• Gene Symbol: VSTM2B
• Gene ID (NCBI): 342865
• RRID: AB_3742965
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A6NLU5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.