VSX2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VSX2 Polyclonal antibody (25825-1-AP)

VSX2 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, ELISA

Cat No. 25825-1-AP

Publications(5)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, IF-Fro, ChIP, ELISA

Synonyms

Ceh-10 homeodomain-containing homolog, CHX10, Homeobox protein CHX10, HOX10, MCOP2

• 

  WB analysis of mouse eye using 25825-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 25825-1-AP (VSX2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human retinoblastoma using 25825-1-AP

  Immunohistochemical analysis of paraffin-embedded human retinoblastoma tissue slide using 25825-1-AP (VSX2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human retinoblastoma using 25825-1-AP

  Immunohistochemical analysis of paraffin-embedded human retinoblastoma tissue slide using 25825-1-AP (VSX2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 25825-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25825-1-AP (VSX2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 25825-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25825-1-AP (VSX2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse eye using 25825-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using VSX2 antibody (25825-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse eye using 25825-1-AP

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse eye tissue using VSX2 antibody (25825-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse eye tissue
• Positive IHC detected in: human retinoblastoma tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse eye tissue
• Positive IF-Fro detected in: mouse eye tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25825-1-AP targets VSX2 in WB, IHC, IF-P, IF-Fro, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23035

  Product name: Recombinant human VSX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC128153

  Sequence: MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRK

• Full Name: visual system homeobox 2
• Calculated Molecular Weight: 361 aa, 39 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC128153
• Gene Symbol: VSX2
• Gene ID (NCBI): 338917
• RRID: AB_2880257
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P58304
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Stem Cell; Human brain organoids assemble functionally integrated bilateral optic vesicles.; Authors - Elke Gabriel
mouse	ChIP	Elife; Gene regulatory mechanisms guiding bifurcation of inhibitory and excitatory neuron lineages in the mouse anterior brainstem.; Authors - Sami Kilpinen
mouse	IF	Pharmacol Res; NAALAD2 mutations disrupt the fate of photoreceptor cells and retinal pigment epithelial cells during early retinal development; Authors - Yuanjie Qian
human	IF	Nat Protoc; Generation of iPSC-derived human forebrain organoids assembling bilateral eye primordia; Authors - Elke Gabriel
mouse	IF	Cell Biosci; NOTCH2NLC GGC repeat expansions cause retinal neurodegeneration in neuronal intranuclear inclusion disease mouse model.; Authors - Haibo Li

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Alessandro (Verified Customer) (11-06-2022)

no unspecific staining, great outcome

• Applications: Immunofluorescence