Tested Applications
| Positive WB detected in | mouse liver tissue, A549 cells, rat liver tissue |
| Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12080-1-AP targets B7‑H4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2712 Product name: Recombinant human VTCN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC065717 Sequence: MFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK Predict reactive species |
| Full Name | V-set domain containing T cell activation inhibitor 1 |
| Calculated Molecular Weight | 282 aa, 31 kDa |
| Observed Molecular Weight | 55-65 kDa |
| GenBank Accession Number | BC065717 |
| Gene Symbol | B7-H4 |
| Gene ID (NCBI) | 79679 |
| RRID | AB_2877822 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z7D3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
B7‑H4 also named VTCN1, B7X, or B7S1 is a 282 amino acid protein, which contains 2 immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7‑H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7‑H4 is a single-pass type I membrane protein, which is over-expressed in breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for B7‑H4 antibody 12080-1-AP | Download protocol |
| WB protocol for B7‑H4 antibody 12080-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The B7-H4 Polyclonal antibody (Cat# 12080-1-AP) has 16 citations across journals including Cancer Letters, Oncogene, Cell Reports, Cell Death Discovery, British Journal of Cancer, Cancer Immunology & Immunotherapy, Scientific Reports, Journal of Virology, Journal of Hepatocellular Carcinoma, Journal of Immunology Research, Digestive Diseases and Sciences, Journal of Oncology, Oncology Letters, and Applied Immunohistochemistry & Molecular Morphology. Research fields span cancer immunology, lung/ovarian/renal/hepatic/colorectal cancers, autoimmune thyroid disease, acute pancreatitis, and HPV infection.
| Species | Application | Title |
|---|---|---|
Cancer Lett Insulin-like growth factor-1 receptor induces immunosuppression in lung cancer by upregulating B7-H4 expression through the MEK/ERK signaling pathway. | ||
Cancer Lett The deubiquitinase USP2a promotes tumor immunosuppression by stabilizing immune checkpoint B7-H4 in lung adenocarcinoma harboring EGFR-activating mutants | ||
Cancer Lett Histone Lactylation Dynamics: Unlocking the Triad of Metabolism, Epigenetics, and Immune Regulation in Metastatic Cascade of Pancreatic Cancer | ||
Cell Death Discov HSP90AA1 restrains clear cell renal cell carcinoma progression by promoting CADM1 expression and suppressing the PI3K-AKT pathway through interaction with FBXO7. | ||
Oncogene B7-H4 is increased in lung adenocarcinoma harboring EGFR-activating mutations and contributes to immunosuppression. | ||
Br J Cancer Spliceosomal GTPase EFTUD2 mediates DDX41 intron retention to promote the malignant progression of ovarian cancer |
Reviews
What customers say
The single available review for this product reports a negative experience. The reviewer used the antibody for immunohistochemistry on breast cancer tissue and rated it 1 out of 5 stars, describing it as non-functional. No additional details or images were provided. Overall, the feedback suggests the product did not perform as expected in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Maelle (Verified Customer) (12-19-2024) | Non-functional
|
