VEGFA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VEGFA Polyclonal antibody (26157-1-AP)

VEGFA Polyclonal Antibody for WB, ELISA

Cat No. 26157-1-AP

Publications(57)

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

L-VEGF , N-VEGF, Vascular Endothelial Growth Factor, vascular endothelial growth factor A, Vascular endothelial growth factor A, long form

• 

  WB analysis of mouse brain using 26157-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26157-1-AP (Vegfa Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26157-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 26157-1-AP (Vegfa antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26157-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 26157-1-AP (VEGFA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 26157-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26157-1-AP (VEGFA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 26157-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26157-1-AP (VEGFA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue, NIH/3T3 cells, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26157-1-AP targets VEGFA in WB, IHC, IF, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Cited Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24084

  Product name: Recombinant mouse Vegfa protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 27-214 aa of NM_001287056

  Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

• Full Name: vascular endothelial growth factor A
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_001287056
• Gene Symbol: Vegfa
• Gene ID (NCBI): 22339
• RRID: AB_2880408
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00731
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vegfa is a member of the PDGF/VEGF growth factor family. It is a mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis, endothelial cell growth, promoting cell migration, and inhibiting apoptosis.It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. It may play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IHC	ACS Nano; Natural Polyphenol-Functionalized Schwann Cell-Derived Exosomes as a Temporal Neuromodulation Strategy for Diabetic Periodontitis Therapy.; Authors - Le Fan
rat	IF	ACS Nano; Flowerbed-Inspired Mg-Loaded Scaffold Accelerates Critical-Sized Bone-Defect Repair by Reprogramming the Microenvironment.; Authors - Xinyue Yang
		J Nanobiotechnology; A sequential dual-drug delivery system for multi-target inhibition of subretinal fibrosis.; Authors - Yu Zhang
rat	IHC	J Nanobiotechnology; Protocatechualdehyde-functionalized BMSC-derived exosomes orchestrate calcium signaling in the immunoinflammatory microenvironment to promote periodontal regeneration.; Authors - Le Fan
rat	WB	Adv Sci (Weinh); A DNA Tetrahedron Delivery Asiatic Acid to Reprogram Mitochondrial Metabolism for Promoting Bone Regeneration via STAT3 Phosphorylation.; Authors - Yiwen Huang
rat	WB	Adv Sci (Weinh); Ultrasound-Activated Bifunctional Piezoelectric Hydrogel Dressings Promote Infected Wound Healing via Regulating Angiogenesis and Lymphangiogenesis.; Authors - Xiang Li