Vitronectin/S-protein Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Vitronectin/S-protein Recombinant monoclonal antibody, PBS Only (Capture) (87005-3-PBS)

Vitronectin/S-protein Uni-rAb^® Recombinant Antibody for WB, IP, Sandwich ELISA, Indirect ELISA

Cat No. 87005-3-PBS

Clone No.252166E4

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IP, Sandwich ELISA, Indirect ELISA

Synonyms

Serum-spreading factor, Somatomedin-B, S-protein, V75, Vitronectin

• 

  WB analysis using 87005-3-RR (same clone as 87005-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87005-3-RR (Vitronectin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87005-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP02822-2

  Plasma of eight individual healthy human donors was measured. The Vitronectin/S-protein concentration of detected samples was determined to be 165.81 μg/mL with a range of 132.65-226.01 μg/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP02822-2

  Sandwich ELISA standard curve of MP02822-2, Human Vitronectin/S-protein Recombinant Matched Antibody Pair - PBS only. 87005-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg4682. 87005-1-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of human plasma using 87005-3-RR (same clone as 87005-3-PBS)

  IP result of anti-Vitronectin/S-protein (IP:87005-3-RR, 4ug; Detection:87005-3-RR 1:1000) with human plasma lysate 3200 ug. This data was developed using the same antibody clone with 87005-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87005-3-PBS targets Vitronectin/S-protein as part of a matched antibody pair:

MP02822-2: 87005-3-PBS capture and 87005-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4682

  Product name: Recombinant Human Vitronectin protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-478 aa of NM_000638.4

  Sequence: DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

• Full Name: vitronectin
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 65-75 kDa
• GenBank Accession Number: NM_000638.4
• Gene Symbol: VTN
• Gene ID (NCBI): 7448
• RRID: AB_3745268
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04004
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vitronectin is a glycoprotein present in blood and in the extracellular matrix (PMID: 10399314). Vitronectin is a multifunctional glycoprotein that mediates cell-to-substrate adhesion, inhibits the cytolytic action of the terminal complement cascade in vitro and binds to several serine protease inhibitors of the serpin family (PMID: 1372588).