Vpr Polyclonal antibody

• 

• Featured Product
• KD/KO Validated

Vpr Polyclonal Antibody for ELISA

Cat No. 51143-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

immunodeficiency virus 1 and More (2)

Applications

WB, ELISA

Synonyms

Vpr

---

Published Applications

• KD/KO: See 2 publications below
• WB: See 12 publications below

Product Information

51143-1-AP targets Vpr in WB, ELISA applications and shows reactivity with immunodeficiency virus 1 samples.

• Tested Reactivity: immunodeficiency virus 1
• Cited Reactivity: human, virus
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0718

  Product name: Recombinant Vpr protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-96 aa of NP_057852

  Sequence: MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASR

• Full Name: Vpr
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: NP_057852
• RRID: AB_10695191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This antibody recognize the VPR gene of Human immunodeficiency virus 1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; HIV reprograms host m 6 Am RNA methylome by viral Vpr protein-mediated degradation of PCIF1; Authors - Qiong Zhang
human	WB	Proc Natl Acad Sci U S A; CHAF1A/B mediate silencing of unintegrated HIV-1 DNAs early in infection.; Authors - Franziska K Geis
	WB	Retrovirology; A functional conserved intronic G run in HIV-1 intron 3 is critical to counteract APOBEC3G-mediated host restriction.; Authors - Marek Widera ; KO Validated
virus	WB	J Biol Chem; HIV-1 Vpu induces caspase-mediated cleavage of IRF3.; Authors - Sang Yoon Park ; KO Validated
	WB	J Biol Chem; HIV-1 Vpr enhances proteasomal degradation of MCM10 through the Cul4-DDB1[VprBP] E3 ubiquitin ligase to induce G2/M cell cycle arrest.; Authors - Bizhan Romani
human	WB	J Biol Chem; HIV-1 Vpr Protein Induces Proteasomal Degradation of Chromatin-associated Class I HDACs to Overcome Latent Infection of Macrophages.; Authors - Bizhan Romani