Tested Applications
| Positive WB detected in | HL-60 cells, K-562 cells, mouse spleen tissue, Jurkat cells, Raji cells |
| Positive IP detected in | Raji cells, rat spleen tissue |
| Positive IHC detected in | human tonsillitis tissue, human lymphoma tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:800-1:3200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10987-1-AP targets WASP in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1444 Product name: Recombinant human WAS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC012738 Sequence: MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPP Predict reactive species |
| Full Name | Wiskott-Aldrich syndrome (eczema-thrombocytopenia) |
| Calculated Molecular Weight | 53 kDa |
| Observed Molecular Weight | 55-62 kDa |
| GenBank Accession Number | BC012738 |
| Gene Symbol | WASP |
| Gene ID (NCBI) | 7454 |
| RRID | AB_2304546 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42768 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Wiskott-Aldrich Syndrome protein (WASP) regulates actin cytoskeleton in hematopoietic cells and defects in WASP cause Wiskott-Aldrich Syndrome (WAS), an X-linked immunodeficiency and autoimmunity disorder of childhood.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for WASP antibody 10987-1-AP | Download protocol |
| IP protocol for WASP antibody 10987-1-AP | Download protocol |
| WB protocol for WASP antibody 10987-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The WASP Polyclonal Antibody (Cat# 10987-1-AP) has 6 total citations. These appear in Nature Communications, Journal of Experimental & Clinical Cancer Research (×2), Advanced Science, Journal of Allergy and Clinical Immunology, and Molecular Cancer Research. Research fields span DNA replication stress, lung and nasopharyngeal cancer metastasis, m6A modification in FSGS, B-cell differentiation, and hepatocellular carcinoma metastasis.
| Species | Application | Title |
|---|---|---|
Nat Commun WASp modulates RPA function on single-stranded DNA in response to replication stress and DNA damage. | ||
J Exp Clin Cancer Res miR-182 suppresses invadopodia formation and metastasis in non-small cell lung cancer by targeting cortactin gene.
| ||
J Exp Clin Cancer Res CDC42-interacting protein 4 promotes metastasis of nasopharyngeal carcinoma by mediating invadopodia formation and activating EGFR signaling. | ||
Adv Sci (Weinh) Mettl3-Mediated m6A Modification Represents a Novel Therapeutic Target for FSGS. | ||
J Allergy Clin Immunol Dedicator of cytokinesis protein 2 couples with lymphoid enhancer-binding factor 1 to regulate expression of CD21 and B-cell differentiation. | ||
Mol Cancer Res LINC00869 Promotes Hepatocellular Carcinoma Metastasis via Protrusion Formation |
Reviews
What customers say
Both reviewers gave this antibody a 5-star rating. One user compared nine WASp antibodies from four different companies for ELISA and EMSA super-shift, finding this antibody produced excellent ELISA results and was the only one to show clear shifted bands for the WASp binding complex. A colleague also reported a clean, strong signal in Western blot. The second reviewer simply noted the antibody was clean and performed well in Western blot. Overall, users highlight its specificity, clean bands, and reliable performance across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Seong-Su (Verified Customer) (09-17-2020) | I checked nine WASp Abs from 4 different companies for ELISA and EMSA super-shift. Among them this proteintech WASp Ab showed wonderful result for ELISA as well as was the only Ab that showed shifted bands of WASp binding complex.My colleague used this Ab for western and got a beautiful result.
|
Nisreen (Verified Customer) (11-07-2017) | The antibody are clean and nice.
|
