WASL Polyclonal antibody

• 

  WB analysis using 14306-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14306-1-AP (WASL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

WASL Polyclonal Antibody for WB, ELISA

Cat No. 14306-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

Actin nucleation-promoting factor WASL, N WASP, Neural Wiskott-Aldrich syndrome protein, NWASP, N-WASP

---

Tested Applications

• Positive WB detected in: HeLa cells, MDA-MB-231 cells, SH-SY5Y cells, SK-N-SH cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below
• IHC: See 3 publications below
• IF: See 3 publications below
• CoIP: See 1 publications below

Product Information

14306-1-AP targets WASL in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5424

  Product name: Recombinant human WASL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC052955

  Sequence: MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPAL

• Full Name: Wiskott-Aldrich syndrome-like
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC052955
• Gene Symbol: WASL
• Gene ID (NCBI): 8976
• RRID: AB_10638478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00401
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Immunol; FLI1 Induces Megakaryopoiesis Gene Expression Through WAS/WIP-Dependent and Independent Mechanisms; Implications for Wiskott-Aldrich Syndrome.; Authors - Chunlin Wang
mouse,human	WB,IF,CoIP	iScience; WASH interacts with Ku to regulate DNA double-stranded break repair.; Authors - Tao Wang
human	WB	J Dermatol Sci; Negative pressure accelerated monolayer keratinocyte healing involves Cdc42 mediated cell podia formation.; Authors - Hsu Chih-Chin CC
human	WB	Neuroreport; Decreased expression of cortactin in the schizophrenia brain.; Authors - Hriday P Bhambhvani
human	WB,IHC,IF	Noncoding RNA Res; ADAR1-regulated miR-142-3p/RIG-I axis suppresses antitumor immunity in nasopharyngeal carcinoma; Authors - Haoyuan Xu
human	IF	Mol Cell; The Functional Proximal Proteome of Oncogenic Ras Includes mTORC2.; Authors - Joanna R Kovalski