WASP Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP01520-3

  Sandwich ELISA standard curve of MP01520-3, Human WASP Recombinant Matched Antibody Pair - PBS only. 84714-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1444. 84714-5-PBS was HRP conjugated as the detection antibody. Range: 125-8000 pg/mL.

• 

  Sample test of MP01520-3

  The mean WASP concentration was determined to be 36.6 ng/mL in HL-60 cell extract based on a 1.4 mg/mL extract load, 9.6 ng/mL in K-562 cell extract based on a 2.4 mg/mL extract load, 17.9 ng/mL in Jurkat cell extract based on a 1.5 mg/mL extract load and 30.7 ng/mL in Raji cell extract based on a 1.4 mg/mL extract load.

WASP Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84714-4-PBS

Clone No.242074B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Wiskott-Aldrich syndrome protein, WAS, Actin nucleation-promoting factor WAS, 242074B11

---

Product Information

84714-4-PBS targets WASP as part of a matched antibody pair:

MP01520-3: 84714-4-PBS capture and 84714-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1444

  Product name: Recombinant human WAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC012738

  Sequence: MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPP

• Full Name: Wiskott-Aldrich syndrome (eczema-thrombocytopenia)
• Calculated Molecular Weight: 53 kDa
• GenBank Accession Number: BC012738
• Gene Symbol: WASP
• Gene ID (NCBI): 7454
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42768
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.