WBP2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• WBP2 Monoclonal antibody (66585-1-Ig)

• Featured Product
• KD/KO Validated

WBP2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66585-1-Ig Copied!

Clone No. 2B4G7

Publications (2)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

WBP 2, WBP2, WW domain binding protein 2

• 

  WB analysis of HEK-293 using 66585-1-Ig

  WB result of WBP2 antibody (66585-1-Ig; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-WBP2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66585-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66585-1-Ig (WBP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 66585-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66585-1-Ig (WBP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 66585-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 66585-1-Ig (WBP2 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 66585-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 66585-1-Ig (WBP2 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66585-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using WBP2 antibody (66585-1-Ig, Clone: 2B4G7 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66585-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using WBP2 antibody (66585-1-Ig, Clone: 2B4G7 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for WBP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, NIH/3T3 cells, MCF-7 cells, Jurkat cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66585-1-Ig targets WBP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2661

  Product name: Recombinant human WBP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-261 aa of BC010616

  Sequence: MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPSGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ

• Full Name: WW domain binding protein 2
• Calculated Molecular Weight: 261 aa, 28 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: BC010616
• Gene Symbol: WBP2
• Gene ID (NCBI): 23558
• RRID: AB_2881945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q969T9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Antibody 66585-1-Ig targets WW domain-binding protein 2 (WWP2). It has a total of 2 citations, appearing in Cell Death & Disease and FASEB Journal. The cited research covers two fields: one study demonstrated that WWP2 overexpression prevents diet-induced liver steatosis and insulin resistance through AMPKβ1 signaling in human cells, while the other showed that WWP2 aggravates neointimal hyperplasia by promoting Y-box binding protein 1 nuclear translocation in a mouse model. Both studies used immunofluorescence (IF) as the application.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Death Dis; WW domain-binding protein 2 overexpression prevents diet-induced liver steatosis and insulin resistance through AMPKβ1.; Authors - Zhe Zheng ; KO Validated
mouse	IF	FASEB J; WW Domain-Binding Protein 2 Aggravates Neointimal Hyperplasia by Promoting Y-Box Binding Protein 1 Nuclear Translocation.; Authors - Lili Xiao ; KO Validated