WBSCR16 Polyclonal antibody

• 

  WB analysis of HeLa using 13796-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13796-1-AP (WBSCR16 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13796-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13796-1-AP (WBSCR16 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

WBSCR16 Polyclonal Antibody for WB, ELISA

Cat No. 13796-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

RCC1L, wbs16, WBSCR16

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below

Product Information

13796-1-AP targets WBSCR16 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4619

  Product name: Recombinant human WBSCR16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC032712

  Sequence: MALVALVAGARLGRRLSGPGLGRGHWTAAGRSRSRREAAEAEAEVPVVQYVGERAARADRVFVWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQKISSAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDLAGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHFSGVGKVRQAACGGTGCAV

• Full Name: Williams-Beuren syndrome chromosome region 16
• Calculated Molecular Weight: 464 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC032712
• Gene Symbol: WBSCR16
• Gene ID (NCBI): 81554
• RRID: AB_2214934
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96I51
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO Rep; A pseudouridine synthase module is essential for mitochondrial protein synthesis and cell viability.; Authors - Hana Antonicka
human	WB	PLoS Genet; RCC1L (WBSCR16) isoforms coordinate mitochondrial ribosome assembly through their interaction with GTPases.; Authors - Aurelio Reyes
human	WB	EMBO J; Ribonucleotide synthesis by NME6 fuels mitochondrial gene expression; Authors - Nils Grotehans ; KO Validated
human	WB	Nat Cell Biol; Regulators of mitonuclear balance link mitochondrial metabolism to mtDNA expression; Authors - Nicholas J Kramer