Use Able AI chat for product recommendations

WBSCR17 Polyclonal antibody

WBSCR17 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21280-1-AP
Reviews (1)
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

EC:2.4.1.41, GalNAc T like protein 3, GalNAc-T-like protein 3, GALNT17, Polypeptide GalNAc transferase-like protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for WBSCR17 in ?

Tested Applications

Positive WB detected inmouse brain tissue, A549 cells, mouse lung tissue, human brain tissue
Positive IHC detected inhuman brain tissue, mouse brain tissue, mouse cerebellum tissue, human heart tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21280-1-AP targets WBSCR17 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15792

Product name: Recombinant human WBSCR17 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-126 aa of BC069624

Sequence: MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE

Predict reactive species
Full Name Williams-Beuren syndrome chromosome region 17
Calculated Molecular Weight 598 aa, 68 kDa
Observed Molecular Weight70~90 kDa
GenBank Accession NumberBC069624
Gene Symbol WBSCR17
Gene ID (NCBI) 64409
RRIDAB_10732815
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6IS24
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WBSCR17, also known as GALNT17, which encodes a brain-expressed N-acetylgalactosaminyl transferase (GalNAcT), is located at the distal edge of a region that is commonly deleted or duplicated in Williams Beuren Syndrome (WBS), a developmental disorder with motor and coordination problems, impaired visuospatial memory, and abnormal social interaction (PMID: 31554716). WBSCR17 loss-of-function has significant effects on cerebellar development, and is associated with phenotypes including developmental delay, deficits in motor coordination, reduced exploratory activity, and impaired social behavior (PMID: 22787146). With the calculated molecular mass of recombinant WBSCR17 being 68 kDa, the 70-90-kDa glycoproteins could also be detected due to post-translational modifications (PMID: 22787146).

Protocols

Product Specific Protocols
IHC protocol for WBSCR17 antibody 21280-1-APDownload protocol
WB protocol for WBSCR17 antibody 21280-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One customer review is available for this product. Jennifer Munkley rated it 5 stars and used it for immunohistochemistry on human cancer tissue (lot 00014651), noting that it "works well for IHC." Overall, the feedback is positive, with the reviewer confirming reliable performance in their intended application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Jennifer (Verified Customer) (04-24-2026)

Works well for IHC

  • Applications: Immunohistochemistry
  • Cell Tissue Type: human cancer tissue
Loading...
||
New chat

Able™

正在加载,请稍候...